KEGG   Bacillus coagulans 2-6: BCO26_2625Help
Entry
BCO26_2625        CDS       T01527                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bck00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BCO26_2625
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCO26_2625
  Lipid metabolism
   00071 Fatty acid degradation
    BCO26_2625
  Amino acid metabolism
   00350 Tyrosine metabolism
    BCO26_2625
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCO26_2625
   00626 Naphthalene degradation
    BCO26_2625
Enzymes [BR:bck01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BCO26_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2699125..2700147)
Genome map
AA seq 340 aa AA seqDB search
MRAAVVSSDKQKLVEVKDVQLRPLEYGEALVDIEYCGVCHTDLHVAKGDFGDVPGRILGH
EGVGIVREVADGVTSLKVGDRVSVAWFFEGCGHCEYCLTGNETFCRNVKNAGYSVDGAMA
EQCIVKADYAVKVPEGLDPRQATSITCAGVTTYKAIKVADVKPGEWIAIYGAGGLGNLAV
QYAKHVFNAKVIAVDINDDKLSLAKEVGADLTFNSKTDGDPAEWIQKEVGGAHAAVVTAV
SKQAFNQAVHSVRPVSKVVAVGLPPETMDLEIVKTVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVHTRRLEEVGDVFKEMEEGRIQGRMVLDMSLK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagcagtcgtcagttctgataagcaaaaactggtagaggtcaaagatgtgcag
ttgcgtccacttgaatatggggaagctttggtggatatcgaatactgcggtgtctgtcat
acggatctgcatgtggcaaagggcgactttggcgatgtgccgggacgcattctcggccat
gaaggggtcggcattgtcagggaagtcgcggatggtgtcacttctcttaaagtgggcgat
cgtgtaagcgttgcctggttttttgaaggctgcgggcattgtgaatactgtttaacggga
aatgaaacattttgccgtaatgtgaaaaatgcaggctacagtgtcgacggggctatggca
gagcaatgcattgtcaaagcggattacgccgtaaaagtgccggaagggctggatccaagg
caggcgacaagcattacttgtgccggtgtaaccacttataaagctattaaagtcgcagat
gtgaagccgggcgaatggattgccatttatggagcagggggcctcgggaaccttgctgtc
cagtacgccaaacatgtatttaatgcgaaagtcattgcggtcgatatcaatgacgacaaa
ctttcactggcaaaagaagtcggtgctgatctcacctttaattccaaaacggatggcgat
ccggctgagtggattcagaaagaagttggcggcgcgcatgctgcagtggtaacggctgtt
tcgaaacaggcattcaaccaggctgtccactccgtacggccggtgtcaaaagtcgttgct
gtcgggctccctccggaaacaatggatcttgaaattgtgaaaacagtccttgacgggata
gaagtcgtcgggtctttggttggcacaagaaaagaccttgaggaagcttttatgttcggt
gcggaaggaaaagtcgtcccggttgtgcacacgcgcagactggaagaagtgggagatgtg
tttaaagaaatggaagaaggcagaatacagggcaggatggtcctggatatgtcgttgaaa
taa

DBGET integrated database retrieval system