KEGG   Bacillus coagulans 2-6: BCO26_2840Help
Entry
BCO26_2840        CDS       T01527                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bck  Bacillus coagulans 2-6
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bck00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2923178..2924050)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGHVFIGASPDYEKSRVVLYGMPMDWTVSYRPGSRFGPGRIREVSIGLEEYSP
YLDRELAEISYFDAGDMPLPFGNPQKSLDMIENYVGTLLDDGKFPFGLGGEHLVTWPVIR
AVYKKYPDLAVIHFDAHTDLRTDYEGEPLSHATPIRKTAELIGPANVYSFGIRSGLKEEF
EWAERNGMHIAKFEVLEPLKKVLPALSDRHVYVTVDIDVLDPAFAPGTGTVDAGGITSKE
LLASIHVIARSGVNVIGCDLVEVAPVYDHSEQTANTASKLVREMMLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgacgaagcttattcaggccatgtttttatcggggcaagcccggattatgaa
aaaagccgggtggtgctttacggcatgccgatggactggacagtcagctaccgcccgggt
tcacggttcggcccggggcgcatccgggaagtttcaatcgggctcgaagaatacagcccg
tatcttgaccgggaacttgctgaaatcagctattttgatgccggagatatgccgctgccg
ttcggcaatccgcaaaaaagccttgatatgattgaaaattatgtcgggacattgctcgac
gacgggaaatttccgttcggccttggcggcgagcatttggtgacatggccggtgatccgc
gccgtttacaaaaaatacccggatctcgctgtcattcattttgatgcccataccgatttg
cgcacggattatgaaggcgagccgctttcgcatgctacgccgatccggaaaacggcggag
ttgatcgggcccgcgaatgtgtattcattcggtatccggtccggcttaaaagaggaattt
gaatgggcggaaagaaacggcatgcatatcgcaaagtttgaagtgcttgagccgctcaaa
aaagtgttgccggcgctttccgaccgccatgtgtatgtgacggtcgatattgatgtgctc
gatcccgcttttgcgccggggacagggacggtggatgccggcgggatcacctcaaaagaa
ctgctggcatcgattcatgtgattgcccgttccggcgtgaatgtcattggttgtgacctt
gttgaagtggcacctgtatatgatcattccgagcaaacagccaatacggctagcaagctc
gtgcgcgaaatgatgctcggctgggtgaagtaa

DBGET integrated database retrieval system