KEGG   Bacillus coagulans 2-6: BCO26_2871Help
Entry
BCO26_2871        CDS       T01527                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bck  Bacillus coagulans 2-6
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bck00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bck00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bck02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2954497..2955768)
Genome map
AA seq 423 aa AA seqDB search
MGKKNRMMKAAIALSAVAVLGISGIANAKAYKPSQHTGHATSAKTKNVILFVGDGMGAAQ
RDAIRLASTGLSGDLEMNKMPYTGVVHTSSTSVVTDSAAAATAMASGVKTYNGAIGVDAN
KVSKRTVLEEAKQAGKSTGLVTTSQITDATPAAFGAHVENRSEQSKIAKQYLKNSKVDVL
LGGGEDYWYPQGTQGAYKDHPAKDTSEASKGTEGNLVDEAKRLGYQYVSDASGLKKAGGN
KLLGLFANEEMFEQREEGQGDQYDPVVSLPEMTKKAISTLSKNKNGFFLMVEEEAIDEMA
HENNASQLIKAGRQLDHAVKVAKDYAKKHPDTLVLVLADHDCGGMTVESADNSDESGDGI
SKEDGPFQVAGSSAQFVVDWTTSGHTAADIPLTATGSGASLFEGTYENTYIHDALLRAMG
LKK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaaaagaaccgtatgatgaaagcggcaattgccttgtctgcagtggcggtattg
gggatatccgggattgcaaatgcaaaagcttacaagccttcgcaacacaccggtcacgcc
acttccgcgaagacgaagaacgtgattctgtttgtcggggatggtatgggggctgcgcaa
cgggatgcgatccgccttgcttcaaccggactgagcggggaccttgaaatgaacaaaatg
ccgtatacgggggttgtacatacaagctccacctccgtggtgaccgattcagctgcggct
gcgaccgctatggcgtcaggcgttaaaacgtataacggggcaatcggtgtcgatgccaat
aaagtaagcaaaaggaccgtccttgaagaagcaaagcaagccggcaagtcaacaggattg
gtcacgacaagccaaatcacagatgcaacgcctgccgctttcggtgcccatgtcgaaaac
cgttctgaacagagcaaaattgcaaagcaatatttgaaaaacagcaaagtggacgtgttg
ctcggcggcggggaagattactggtacccgcaaggcacacagggcgcttataaagaccac
ccggcaaaagatacttccgaagcaagcaaaggcacggaaggaaatcttgtcgacgaagcg
aaacggctcggttaccagtatgtttcagatgcttccggactgaaaaaggcaggcgggaat
aagcttttaggcctttttgccaatgaagaaatgtttgaacagcgagaggaaggccaaggc
gaccagtacgacccggttgtttcacttccggaaatgacaaaaaaagcaatcagcacgctg
tcaaaaaataaaaacggctttttcctgatggttgaagaagaagccatcgatgaaatggcc
catgaaaataacgcctcccagctgatcaaggcgggccggcaactggatcatgccgtaaaa
gtggcaaaggattatgcgaaaaagcacccggatacacttgtgctcgtcctggccgaccat
gactgcggcggcatgacggttgaaagtgccgataacagcgacgaatccggggacggcatt
tcaaaagaagacggaccgttccaggtggcgggttccagcgcgcaatttgttgtggactgg
acaacttccggccatacggcagccgatatcccgctcacggcgacaggcagcggcgcatcg
ttgtttgaaggcacttatgaaaacacatatatccatgatgctttgctgagagcgatgggg
ctgaaaaaataa

DBGET integrated database retrieval system