KEGG   Bacillus clausii: ABC0039Help
Entry
ABC0039           CDS       T00228                                 

Gene name
recR
Definition
(GenBank) recombinational DNA repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
bcl  Bacillus clausii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABC0039 (recR)
DNA repair and recombination proteins [BR:bcl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ABC0039 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ABC0039 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
50889..51488
Genome map
AA seq 199 aa AA seqDB search
MQYPRPIAKLIEGFTRLPGIGPKTASRLAFHVLDMKEDDVLEFAKALVHAKRDLTYCSQC
HNITDTDPCQICEDKHRDRTTICVVQESRDLIAMEKMREYTGLYHVLHGAISPMDGIGPE
DIKIAELIKRLQDDESVKEVIVATNPTIEGEATAMYISRLIKPTGIKVTRLAHGLPVGGD
LEYADEVTLSKAIEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatacccgagaccgattgcaaaattaatagaagggttcacgaggctcccgggaatt
gggccaaaaacagcaagccgccttgcctttcatgtccttgatatgaaggaagacgatgtg
cttgagtttgcgaaagcccttgtccatgcaaaacgggatttaacttactgctctcaatgc
cataacatcacagatacggatccatgccaaatttgtgaagataagcatagagaccgtaca
acgatttgtgttgtccaagaatcacgagatttaattgcaatggagaaaatgcgggaatac
accgggctttaccatgttttacacggggcgatttcgccgatggatggaatcgggccagaa
gatattaaaatcgcggaactgatcaaacgtttgcaggatgacgagagcgtaaaagaagtc
attgttgccaccaatccaaccattgaaggagaggcaacggcgatgtatatttcacgctta
attaaacctactggcattaaagtgacgcgcctagcccatggtttgcctgtcggtggcgat
ttggaatatgctgatgaagtaacgctttctaaagcaattgaaggtagacgcgaattgtaa

DBGET integrated database retrieval system