KEGG   Bacillus clausii: ABC0046Help
Entry
ABC0046           CDS       T00228                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcl  Bacillus clausii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABC0046 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC0046 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    ABC0046 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABC0046 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABC0046 (adhA)
   00626 Naphthalene degradation
    ABC0046 (adhA)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABC0046 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62619..63668
Genome map
AA seq 349 aa AA seqDB search
MSKTSERRMMKAAVVNQFNQQLEIKEVPVPTVEYGEVLVKIKACGVCHTDLHAAHGDWPV
KPKLPLIPGHEGVGIVEEIGEGVTSIKVGDRVGIPWLYSACGECEYCLTGRETLCPDQLN
AGYSVDGGYAEYCKAPANYIVKIPENLDFAEVSPIFCAGVTTYKALKVADAKAGDWVAIY
GIGGLGHVALQYAKAMGYNVVAVDIMEDKLELAKRLGADLTVNGLQVDPVQEIKEKVGGV
QAAISVAVTKKAFEQAYGSVKRGGTLVVVGLPNDELPIPIFDTVLNGVTVKGSIVGTRKD
LQESIEFAAQGKVRTNIETQPLDKINEVFERMENGKINGRVVLTIDETA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacaagcgaacgaagaatgatgaaagcggcggtcgttaatcagttcaatcaa
caattagagattaaggaagttccggtacctaccgtggagtatggagaggtgcttgtcaaa
attaaggcttgcggtgtttgtcatacagacttgcatgccgctcatggagattggccagta
aagccaaagcttcctcttattcctggtcatgagggagtaggtattgtagaggaaatagga
gaaggggtcacttcgataaaggtaggagatcgggtcggcattccgtggctttactctgca
tgtggagagtgtgagtattgtttaacaggccgtgagacgttatgccctgaccaattaaat
gcaggttattcagtggatgggggatatgcagagtattgtaaggcgcctgccaattatata
gtgaaaatacctgagaatcttgattttgctgaagtgtcccctattttttgcgcaggggtg
acgacttacaaagcattaaaagtagccgatgccaaagccggtgactgggttgccatttat
ggaatcggtggattgggtcacgttgctttgcagtacgcaaaagcaatgggctataacgtc
gtcgctgtcgatattatggaggacaaacttgaattagcaaaacgtcttggagctgattta
acagtcaatggacttcaggtagaccctgttcaagaaataaaagaaaaagtgggcggagtt
caagcagctattagcgtggcagtcacaaaaaaagcatttgagcaagcttacggatctgtc
aaaagaggagggacattagtcgttgtgggccttccaaacgatgaattgcccattccgatt
ttcgatacggtgctaaacggtgtaaccgtgaaaggctcaatcgtagggacgcgcaaagac
ttgcaagaatcgattgaatttgcagcacaagggaaagtgcgaaccaacatcgaaacacag
ccgctcgataaaattaacgaagtgtttgaaagaatggagaatggaaaaattaacggtcgt
gttgtgttaacaattgatgaaaccgcttaa

DBGET integrated database retrieval system