KEGG   Bacillus clausii: ABC0074Help
Entry
ABC0074           CDS       T00228                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bcl  Bacillus clausii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bcl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91560..92453
Genome map
AA seq 297 aa AA seqDB search
MKYSIKAPAKINLSLDVIRKREDGYHEVEMIMTMVDLADRVDLSLRADGGISIDVSEGFV
PSDERNFAYQAASLLKKRYNVREGVHIYITKRIPVAAGLAGGSSDAAATLKGLNELWQLG
LSVDELATLGAEIGSDVSFCVYGGTALATGRGELIKPIASPPPLWVILAKPPIGLSTADV
YNGLKLSEARHAKTAEMIAALERQDAASICALLHNTLEDVTLRLYPEVAHIKEQMKRFGA
NGVLMSGSGPTVFGIVEKESRVNRIYNGLRGFCDEVYAVRLIRTSGTCPNTDENGML
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtattcaattaaagcgcctgcaaagatcaatttgtcccttgatgtgataaggaaa
cgggaagatggttatcatgaagttgaaatgatcatgacaatggttgacttagctgaccga
gtagacttatcactgcgggccgatggaggcatatcgatagacgtttctgaagggtttgtc
ccgagtgatgagcggaactttgcttaccaagcggcatcgttattaaaaaaacgatacaac
gttagagagggcgtacacatttacattacgaaacggataccagtagcagccggcctggct
ggcggaagcagtgatgcagctgcaacgttaaagggcttaaatgagctttggcagcttggt
ctttcagtggatgaactagcgacactaggcgctgagattggttctgacgtttctttttgt
gtgtacggcggcacggcgctagcgacaggcagaggagagctaattaagccgattgcttcc
ccaccgccattatgggtgattttggcaaagccgcccattggcctatcaacggcagacgtt
tataatggcctaaaattaagcgaggcaaggcatgcaaaaacagcagagatgatcgcggca
cttgagcgccaagacgcagcatcaatttgtgcgttgctccataatacgctcgaagatgtg
acgctacgcctttatccagaggtcgcccatattaaagagcaaatgaagcgttttggcgct
aacggtgtattaatgagtggaagcggtccgacggttttcggcattgtcgaaaaggagtcg
cgggttaaccggatttataacggccttcgtggcttttgtgatgaagtgtacgcagtgcgg
ctgattcgtacaagcggcacttgtccaaatacggatgaaaatggtatgttataa

DBGET integrated database retrieval system