KEGG   Bacillus clausii: ABC0315Help
Entry
ABC0315           CDS       T00228                                 

Definition
(GenBank) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC0315
   00500 Starch and sucrose metabolism
    ABC0315
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ABC0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: BAD62857
UniProt: Q5WL98
Position
345108..346496
Genome map
AA seq 462 aa AA seqDB search
MTTYLFPPDFWWGTAVSATQIEGAADRDGKGKNIWDHWYEIEPNRFFNEVGPAKTSQFYD
RYKDDIALMKKLGHTSFRFSISWSRLIPAGNGAVNEKAVQFYDQVIDELLAAGITPFVNL
FHFDMPMAMQKIGGFENREVAYAFARYAEICFTHFGDRVKTWFTHNEPIVPVEGGYLYEF
HYPKVVDFKRAVQVGYHTMLSSALAIERYRRLGQGGKIGIILNLTPSYPRAEENERDVEA
AKLADAFFNRSFLDPSVKGTFPQELVAILKQYGLMPHVEEGDKAVISGNTVDLLGVNYYQ
PRRVKAKETPIGDGPLMPGTFFDSYDMPGKKINPHRGWEIYEKGIYDLLMNIKDHYGNIE
CFISENGMGVEGEEKFRDEAGVIQDDYRIEFISNHLRWLHKALTEGANVKGYHLWTFMDN
WSWTNAYKNRYGFVSVDLEKDGKRTVKKSGWWFKTVIENNGF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgtatctgtttccacctgacttttggtgggggacggccgtgtcggctacgcaa
attgaaggagcggcagaccgtgacggcaaaggcaaaaacatttgggatcactggtatgaa
atcgagccaaaccgtttttttaacgaggtagggccagccaaaacatcgcaattttatgat
cgctataaggatgacattgctttaatgaaaaaacttggccatacatcatttcgcttctcc
atctcttggtcaaggcttattcctgcaggaaatggcgcggtgaacgaaaaagcagttcaa
ttttacgatcaagtcattgatgaattgctcgctgcagggattacgccgtttgttaattta
tttcactttgatatgccaatggcgatgcagaaaataggcggttttgaaaaccgtgaagtc
gcctatgcgtttgcccgttacgcggaaatatgctttacgcatttcggggaccgtgtgaaa
acgtggtttacccataatgaaccgattgtgccagtggaaggcggttatttatacgagttc
cattacccgaaagtcgttgatttcaagcgggcagtccaagttggctaccatacaatgctc
tctagtgctctagcaattgaacgctaccgccgtttagggcaaggaggcaagataggcatc
attttaaacttaacaccatcctaccctcgtgcagaggaaaacgaacgagatgtagaagca
gctaaactcgctgatgctttttttaaccgttcttttctcgatccgtctgtgaaagggact
ttcccgcaagaactagtggcaattttaaaacaatatgggcttatgcctcatgtagaagag
ggcgacaaagcagtgatttctggaaatacagttgatttactgggggtgaattattaccaa
ccacgtcgggtgaaagcgaaagagacgcctataggagatggcccgcttatgccaggaaca
ttttttgatagctacgatatgcctggcaaaaaaatcaatccccatcgtggctgggaaatt
tacgaaaaaggcatttatgatttattgatgaacataaaggatcattatggaaatatcgag
tgctttatttctgagaatggaatgggtgttgaaggggaagaaaaattccgtgatgaagct
ggtgttattcaagatgactaccggattgaattcatctcaaaccatttgcgctggctccat
aaagcgctaaccgagggcgctaatgtgaaagggtaccatttgtggacgtttatggacaat
tggtcgtggacaaatgcttataaaaaccgctatggatttgtgtctgttgatttagaaaaa
gatggaaagcggacggttaaaaaaagcggctggtggtttaaaacggtaattgaaaacaat
ggcttctag

DBGET integrated database retrieval system