KEGG   Bacillus clausii: ABC0315Help
Entry
ABC0315           CDS       T00228                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bcl  Bacillus clausii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC0315
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ABC0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345108..346496
Genome map
AA seq 462 aa AA seqDB search
MTTYLFPPDFWWGTAVSATQIEGAADRDGKGKNIWDHWYEIEPNRFFNEVGPAKTSQFYD
RYKDDIALMKKLGHTSFRFSISWSRLIPAGNGAVNEKAVQFYDQVIDELLAAGITPFVNL
FHFDMPMAMQKIGGFENREVAYAFARYAEICFTHFGDRVKTWFTHNEPIVPVEGGYLYEF
HYPKVVDFKRAVQVGYHTMLSSALAIERYRRLGQGGKIGIILNLTPSYPRAEENERDVEA
AKLADAFFNRSFLDPSVKGTFPQELVAILKQYGLMPHVEEGDKAVISGNTVDLLGVNYYQ
PRRVKAKETPIGDGPLMPGTFFDSYDMPGKKINPHRGWEIYEKGIYDLLMNIKDHYGNIE
CFISENGMGVEGEEKFRDEAGVIQDDYRIEFISNHLRWLHKALTEGANVKGYHLWTFMDN
WSWTNAYKNRYGFVSVDLEKDGKRTVKKSGWWFKTVIENNGF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgtatctgtttccacctgacttttggtgggggacggccgtgtcggctacgcaa
attgaaggagcggcagaccgtgacggcaaaggcaaaaacatttgggatcactggtatgaa
atcgagccaaaccgtttttttaacgaggtagggccagccaaaacatcgcaattttatgat
cgctataaggatgacattgctttaatgaaaaaacttggccatacatcatttcgcttctcc
atctcttggtcaaggcttattcctgcaggaaatggcgcggtgaacgaaaaagcagttcaa
ttttacgatcaagtcattgatgaattgctcgctgcagggattacgccgtttgttaattta
tttcactttgatatgccaatggcgatgcagaaaataggcggttttgaaaaccgtgaagtc
gcctatgcgtttgcccgttacgcggaaatatgctttacgcatttcggggaccgtgtgaaa
acgtggtttacccataatgaaccgattgtgccagtggaaggcggttatttatacgagttc
cattacccgaaagtcgttgatttcaagcgggcagtccaagttggctaccatacaatgctc
tctagtgctctagcaattgaacgctaccgccgtttagggcaaggaggcaagataggcatc
attttaaacttaacaccatcctaccctcgtgcagaggaaaacgaacgagatgtagaagca
gctaaactcgctgatgctttttttaaccgttcttttctcgatccgtctgtgaaagggact
ttcccgcaagaactagtggcaattttaaaacaatatgggcttatgcctcatgtagaagag
ggcgacaaagcagtgatttctggaaatacagttgatttactgggggtgaattattaccaa
ccacgtcgggtgaaagcgaaagagacgcctataggagatggcccgcttatgccaggaaca
ttttttgatagctacgatatgcctggcaaaaaaatcaatccccatcgtggctgggaaatt
tacgaaaaaggcatttatgatttattgatgaacataaaggatcattatggaaatatcgag
tgctttatttctgagaatggaatgggtgttgaaggggaagaaaaattccgtgatgaagct
ggtgttattcaagatgactaccggattgaattcatctcaaaccatttgcgctggctccat
aaagcgctaaccgagggcgctaatgtgaaagggtaccatttgtggacgtttatggacaat
tggtcgtggacaaatgcttataaaaaccgctatggatttgtgtctgttgatttagaaaaa
gatggaaagcggacggttaaaaaaagcggctggtggtttaaaacggtaattgaaaacaat
ggcttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system