KEGG   Bacillus clausii: ABC0412Help
Entry
ABC0412           CDS       T00228                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bcl  Bacillus clausii
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ABC0412
  Lipid metabolism
   00561 Glycerolipid metabolism
    ABC0412
   00600 Sphingolipid metabolism
    ABC0412
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ABC0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
460085..461611
Genome map
AA seq 508 aa AA seqDB search
MPFKVAFIGAGSIGFTRMLLRDLLSVPAFSTIEVAFTDINQENLNMVTQLCQRDINENGL
PIQIHATLDRREALTGARYIFNVVRVGGLEAFEQDIDIPLRYGIDQCVGDTLSAGGIMYG
QRGINEMLAICEDIRDVAEQDCLLLNYANPMAMLTWACNHYGGVNTVGLCHGVQGGHRQI
ADVFGLQPEEVDIVCAGINHQTWYIQIKHDGEDLTGKLLEAFENHPEYSKTEKVRIDMLK
RFGYYSTESNGHLSEYVPWYRKRQEEIGDWIDLGTWINGETGGYLRVCKEGRNWFKEDFP
NWMNEPAFVFAESERGQEHGSYIVEALETGRIYRGHFNVVNQNVISNLPSDCIIEAPGYV
DRNGINMPVIGDLPIGCASVCNVSINVQRLAVEAAVAGDDQLLRQAFMMDPLTGAVCTPP
EIWQLVDDMLIAQEKWLPQYKTSIAEAKQRQQTQQRLATKDTSGAARLKTKTVVEMKENR
AEAMKNASQADKAIKRPAAEQSIHSANE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaaagttgcctttattggcgcaggcagcatcggctttacccgcatgttattg
cgggatttgctgtctgttcctgccttttccacaatcgaagtcgctttcacagacatcaat
caggaaaatttgaacatggtgacacagttatgccaacgtgatattaatgaaaacggcctt
cctattcaaatccacgccacccttgaccggagagaagcgttaacaggggcgcgttatatt
tttaacgttgtccgtgttggtggactcgaagcatttgagcaagacatcgatattccgctc
cgttacgggatcgaccaatgtgtaggcgataccctttcagcaggagggattatgtacggc
caacgaggcatcaacgaaatgctcgccatttgcgaagacatccgtgacgttgctgaacaa
gactgcctcctattaaattacgccaatccaatggcgatgctcacatgggcgtgcaaccac
tacggcggtgtcaacacagttgggctatgccacggcgttcaaggcggccatcgccaaatt
gccgacgtgtttgggcttcagccagaagaagtcgacattgtctgcgccggtatcaatcac
caaacctggtacattcaaatcaaacatgacggcgaagatttaacgggcaagttgctcgaa
gcgtttgaaaaccaccctgaatacagcaaaacagaaaaagtacgcatcgatatgctcaag
cgttttggctattacagcacagaatcgaacggccatttaagcgaatatgtaccttggtac
cgaaaacggcaagaggaaattggcgattggattgacctcggcacgtggattaacggcgaa
accggtggctatttgcgcgtttgcaaagaagggcgcaactggtttaaagaagactttcct
aattggatgaacgagccggctttcgtttttgctgaaagcgagcgcggccaagaacatggt
tcctatattgttgaagcgttagaaacagggcgtatctacagagggcattttaatgtggtc
aaccaaaacgtcatctccaatttgccctctgattgcattattgaagcccctggctacgtc
gatagaaacggcatcaatatgcccgtcataggtgacttgcccattggttgcgcctccgtt
tgcaacgtgagcattaatgtccaacgccttgcggtagaggcagccgtagctggagatgac
cagctcttgcggcaagcatttatgatggacccactcactggggccgtatgcaccccacct
gaaatttggcagcttgtcgacgacatgctcattgcccaagaaaaatggctgccccaatat
aaaacaagcattgccgaagccaaacaaaggcaacaaacgcagcaacggctagcgacaaag
gacacgagcggcgcagcccgcctgaaaacgaagactgttgttgagatgaaagaaaatcga
gcggaagcaatgaaaaacgccagtcaagcagacaaagcaataaagcgtccagctgcagag
caaagcattcactctgcaaacgagtaa

DBGET integrated database retrieval system