KEGG   Bacillus clausii: ABC0570Help
Entry
ABC0570           CDS       T00228                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcl  Bacillus clausii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABC0570
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABC0570
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ABC0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
624897..626150
Genome map
AA seq 417 aa AA seqDB search
MNVKDELIVAVEENKQELIDLVCSLIQINTENPPGDTTEISRFIADYLGKDGIDVTWHQS
NEQMYNLIASIGEEGGKELIYCGHTDVVPAGDRDKWSFDPFSGIVEDGWILGRGASDMKA
GLGGLLFATALLKRMGVKLPGKLTLAIVPDEETGGEYGVPWLLERGLIKGDGCLIAEPSS
RLHPTIGQKGSCWFKLDVYGEAGHGSLSPLAGRNAITDAIKAIAAIRTVFDIDVDIPEEV
KPLLAVSRKYMEEVEVEREKYKEILEKISVNIGTIHGGTKSNVIPDTCTVEVDCRLPFGI
TQKEVYAYIEARLDELGIDYAITPFGFRSNANHTPATDPVCTAIINNISYVTKEEAYGVM
QWASSDARHFRDHHIPVLQYGPAYLPSIHNFDEKVKVEDVVLCAKVYVAAVIDFLQQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaagacgaactaattgttgctgtagaagaaaacaaacaagagctcatcgac
ttagtctgttctcttattcagatcaataccgaaaacccccctggcgatacaactgaaata
agtcgcttcattgctgattatttaggcaaagatggaatcgatgttacttggcaccaatcg
aatgaacagatgtataatttgattgcaagcattggcgaggaaggcggaaaagagctaata
tattgcggccatacggacgttgttcctgctggggaccgggataagtggtcgttcgaccct
ttttcaggcattgtcgaagacggctggatcctaggacgtggcgctagcgatatgaaagcg
ggccttggcggcttgctatttgcgactgctttgcttaaacggatgggagtgaaactgcct
gggaaacttacgcttgcaatcgtccctgacgaggaaacaggcggagagtacggagttcct
tggctcctagaaaggggcttaattaagggagacggttgcttaattgcggagccttcttct
cgtttgcatccgacaattggccagaaggggtcttgctggtttaaattggacgtttacggc
gaagcgggccatggaagcttgtccccgcttgcaggccgaaatgcgatcaccgatgcaatc
aaggcaattgcggcaatccgtaccgtttttgacatcgacgtcgatatccctgaagaagtg
aaaccgctccttgctgtttcccgaaaatatatggaagaagtcgaagttgaacgtgaaaaa
tacaaagaaattcttgaaaaaataagcgtcaatattggcacgatccatggggggacaaaa
tccaatgtcatccctgacacctgtacagtcgaagttgattgccgcctgccgtttgggatt
acgcaaaaggaagtgtatgcgtacattgaagcgcgccttgatgagctggggattgattat
gcgattacgcctttcggatttcgcagcaatgccaaccatacgcctgcaaccgatccagtt
tgcacagccattatcaataatatttcctatgtaacgaaagaagaagcgtacggcgtgatg
cagtgggcaagtagcgacgctcgccatttccgtgatcaccatattccagttctccaatac
ggacctgcgtatttgccaagcatccataattttgacgaaaaagtaaaagtggaggacgtt
gtcctttgtgcaaaagtgtatgtagctgctgtgattgattttttgcaacagtaa

DBGET integrated database retrieval system