KEGG   Bacillus clausii: ABC0615Help
Entry
ABC0615           CDS       T00228                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bcl  Bacillus clausii
Pathway
bcl00860  Porphyrin and chlorophyll metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
Module
bcl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABC0615
Enzymes [BR:bcl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ABC0615
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ABC0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: BAD63154
UniProt: Q5WKF1
Position
671750..673180
Genome map
AA seq 476 aa AA seqDB search
MAQKGTVYLIGAGPGDCGLLTAKGLDILRQADVLLYDRLVNPLLLEETKPGAELLYAGKL
PNRHILRQEAIHDEMVRHAQKGKCVVRLKGGDPSVFGRVGEEAAFLDEYAIPYEIVPGVT
AGIAAPAYAGVPVTHRLHGANFAVATGHSRRDTGLPEIDWNGLASIDTVAFYMGIKHLPT
IAENLITHGRPKDEKVLLIQWGTTSKQRTLTADLGTIARKAEAEQFTNPAIALIGDVAAL
NQGKSWFERKPLFGSFPLIANSDGAAQLASLLKEEGAETFVYPRFHEVEEEAPLIHWETA
TDIAFYEEKDVIVFFRWLQKRGLDIRTLSAQFSGETDSAVQALQQRGLAPVQGSRPIGSD
RLFLSRGGLGGKPGWKHIQTRERTVAPSTQTTINRLLDEGHLTDLVFLSRESVECFCEAF
AAIGREKEISELTVLCLSDEAEKAAISYGLSPQIKQSVLSAWMEGNYAGDFICGPR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaagggaacggtttatttaattggtgcagggccgggcgattgtggtttattg
acggcaaaggggcttgacattcttcgccaggcggacgttttattatacgaccgtcttgtc
aacccacttttgctggaagaaaccaaaccaggggctgagctgctgtatgcaggcaagctg
ccgaaccgccatattcttcgccaagaagcgattcatgacgaaatggtgcgccatgcccaa
aaaggaaaatgcgtcgtccgtttaaaaggcggcgatccaagcgtatttgggcgcgttggc
gaagaagcagcctttctcgacgaatacgccataccttacgaaatcgttcctggggtgaca
gcaggaattgcggcgccggcttatgcaggcgttcccgtaacccatcgccttcacggcgcc
aactttgccgttgcgacagggcatagccgcagagacaccggcttgcctgaaatcgattgg
aatgggcttgcctccatcgacacggttgctttttatatgggcattaaacacttgccaacc
attgcagaaaatttaatcacacatggccgcccaaaggacgaaaaagtgttgttaattcaa
tgggggacaacgagcaaacagcggactcttaccgccgacttaggcacgattgcccgaaaa
gcagaagcggaacagttcacgaatccggcgattgccctcattggtgatgtcgcagccctt
aaccaaggaaaaagttggtttgagcgtaaaccattgtttggttcgtttccgctaattgcc
aatagtgacggtgctgcccagcttgcatctttattaaaagaagaaggggctgaaacgttt
gtatacccccgtttccatgaggtagaggaggaagccccgcttattcattgggaaacggct
acagacattgccttctatgaagagaaggatgtcattgtcttttttcgatggctccaaaaa
agaggacttgatatccgtaccctctctgcccaatttagcggtgaaacggattcggcggtg
caggctcttcaacaacgtgggcttgcccctgttcaggggagcagaccaatagggtcagac
cgactctttttaagccgagggggcttaggtggcaagcctggctggaaacacattcaaaca
cgggagcgaaccgttgccccatccacgcaaacgacgataaaccgtctactcgatgaaggg
cacttgactgatcttgtctttttaagccgtgagtccgttgaatgtttttgtgaagcgttt
gctgcgattggcagagagaaggagataagcgagttaactgtgctttgtttaagcgatgaa
gcggaaaaagcagcgatttcctatggtttgtcgccgcaaattaagcaatcggtactgtcg
gcatggatggaggggaactatgcaggcgattttatatgtgggccacggtag

DBGET integrated database retrieval system