KEGG   Bacillus clausii: ABC0761Help
Entry
ABC0761           CDS       T00228                                 

Gene name
aprE
Definition
extracellular alkaline serine protease (EC:3.4.21.-)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bcl  Bacillus clausii
Brite
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     ABC0761 (aprE)
Peptidases [BR:bcl01002]
 Serine Peptidases
  Family S8: subtilisin family
   ABC0761 (aprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
835098..836240
Genome map
AA seq 380 aa AA seqDB search
MKKPLGKIVASTALLISVAFSSSIASAAEEAKEKYLIGFNEQEAVSEFVEQIEANDDVAI
LSEEEEVEIELLHEFETIPVLSVELSPEDVDALELDPTISYIEEDAEVTTMAQSVPWGIS
RVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGT
IAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSP
SATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAG
LDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTAT
GLGNTNLYGSGLVNAEAATR
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaccgttggggaaaattgtcgcaagcaccgcactactcatttctgttgctttt
agttcatcgatcgcatcggctgctgaggaagcaaaagaaaaatatttaattggctttaat
gagcaggaagcagttagtgagtttgtagagcaaatagaggcaaatgacgatgtcgcgatt
ctctctgaggaagaggaagtcgaaattgaattgcttcatgagtttgaaacgattcctgtt
ttatctgttgagttaagtccagaagatgtggacgcgcttgagctcgatccaacgatttcg
tatattgaagaggatgcagaagtaacgacaatggcgcaatcagtgccatggggaattagc
cgtgtacaagccccagctgcccataaccgtggattgacaggttctggtgtaaaagttgct
gtcctcgatacgggtatttccacccatccagacttaaatattcgcggtggtgctagcttt
gtgccaggagaaccatccactcaagatggaaatggacatggcacgcatgtggcagggacg
attgctgctttaaacaattcgattggcgttctgggcgtagcaccgagcgcggaactatac
gctgtaaaagtattaggcgcgagcggttcaggttcggtcagctcgattgcccaaggattg
gaatgggcagggaacaatggcatgcacgttgcgaatttgagtttaggaagcccgtcgccg
agtgcaacacttgagcaagctgttaatagcgctacttctagaggcgttcttgtcgtagca
gcatctggtaattcaggtgcaggctcaatcagctatccggcccgttatgcgaacgcaatg
gcagtcggagcgactgaccaaaacaacaaccgcgctagcttttcacagtatggagctggg
cttgacattgtcgcgccaggtgtcaatgtgcagagcacatacccaggttcaacatatgcc
agcttaaacggtacatcgatggctactcctcatgttgcaggtgtagcagcccttgttaaa
caaaagaatccatcttggtccaatgtacaaatccgcaatcatctaaagaatacggcaacg
ggtttaggaaacacgaacttgtatggaagcgggcttgtcaatgcagaagcggcaacacgc
taa

DBGET integrated database retrieval system