KEGG   Bacillus clausii: ABC1148Help
Entry
ABC1148           CDS       T00228                                 

Definition
xylosidase/arabinosidase (EC:3.2.1.37 3.2.1.55)
Orthology
K01198  
xylan 1,4-beta-xylosidase [EC:3.2.1.37]
K01209  
alpha-N-arabinofuranosidase [EC:3.2.1.55]
Organism
bcl  Bacillus clausii
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bcl00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bcl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254230..1255801
Genome map
AA seq 523 aa AA seqDB search
MEPFNNPIIPGFYPDPSICRVNEDYYLVTSTFEYFPGVPIFHSTDLVNWRQIGHVLDRPE
QLNLDGTPNSRGIYAPTIRYNNGLFYMITTFVESQHGARRNFFVTAKDPAGPWSDPVWIK
GAPGIDPSLFFDDDGRVYYTGNRVPPTGQTHAKHMEIWLQEIDPITGCLLGEPTGIWDGA
LKIAHAQEAPHLYKKDGYYYLFIAEGGTGFTHAVTVARSREIAGPYEANRRNPVLTHRHL
GQDYPITNVGHADIVQTQDDEWWLVCLGSRPYGGMYRNMGRETFLAPMRWEDDWPVVCPE
TGKIEVEMPGPSLPRQKVEPLPVRDDFNARKLGFQWNMIRTPRTPFYSLEARKGYLQLNV
RPETLADQANPSFIGRRQQHRSFTVRAFMEFDPKQSGEAAGLALFYSQKNHYRFELIRSG
QLFIRLVKVEDGVETVAGKSTAPIPATAIEWQVAADLQELSFSYRVPGGKWRMVANKQDS
RLLSTDRAGGFVGTYIGMFATSNGQNSTTTAAFDWFEYKGEST
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccgtttaacaatccgatcattccgggattttatcctgacccgtcgatttgcagg
gtaaacgaagactattatttagtcacgtctacatttgagtattttcccggtgtgccgatt
tttcattcaaccgatcttgtcaattggcggcagattggccatgtattagaccgtccagag
cagctcaatcttgatggcaccccgaattcacggggaatttatgcgccgacgatccgttac
aataatggactgttttatatgatcaccacatttgtggaaagccaacacggggcaagacgc
aatttctttgtgacggcaaaagacccggctggaccttggtcagacccagtttggataaag
ggggcgcctgggattgacccatccttgttttttgatgatgatggccgcgtctattacaca
ggcaatcgtgtcccccctacagggcaaacgcacgccaagcatatggaaatttggctccag
gaaatcgatcccattacaggctgcctgcttggcgaaccgactgggatttgggatggtgcg
ctaaaaatagcccatgcccaggaagcaccccatctttataaaaaagacggctactattac
ttgtttattgccgaaggggggactggattcacccatgcggtgacagttgcgcgaagccgg
gagattgccggcccttatgaggcgaatcggcgcaaccccgtgctgacgcaccgccatctc
ggccaggactacccgatcacgaatgtaggccacgccgatatcgtccaaacacaagacgat
gaatggtggcttgtctgtttaggttcccgcccatatgggggcatgtaccgcaatatgggg
cgtgagacgtttttagcgcctatgcgctgggaggacgattggcctgttgtttgtcctgag
acagggaaaatcgaagtcgagatgccaggcccgtctttgccgcggcaaaaggtggaaccc
ttgccggtccgggatgattttaacgctcgcaagctaggctttcaatggaatatgatccgc
acgccgcggacgccgttttattcccttgaagcgaggaaagggtatttacagttaaacgtt
cgcccggaaacacttgctgaccaggcgaatccaagttttatcgggcgccgccagcaacat
cgatcgtttactgtccgcgcttttatggaattcgatcctaagcaaagtggcgaggctgct
ggacttgctttattttacagccagaaaaaccattaccgctttgaacttatacgtagtggg
cagttgtttatacggctcgtaaaagtggaagatggcgtggaaacggtggcaggtaaaagc
acggcgccgattccggcaacggcgattgaatggcaagttgccgccgatttgcaagaactt
tcgttttcataccgtgtgccaggtggcaagtggcgcatggtcgctaataagcaagatagc
aggctattgagcacagatcgagcagggggctttgtcggcacctatattggcatgtttgcg
acaagcaacggacaaaacagcacaacgacagccgcatttgattggtttgaatacaagggg
gaatcgacatga

DBGET integrated database retrieval system