KEGG   Bacillus clausii: ABC1148Help
Entry
ABC1148           CDS       T00228                                 

Definition
xylosidase/arabinosidase (EC:3.2.1.37 3.2.1.55)
Orthology
K01198  
xylan 1,4-beta-xylosidase [EC:3.2.1.37]
K01209  
alpha-N-arabinofuranosidase [EC:3.2.1.55]
Organism
bcl  Bacillus clausii
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ABC1148
   00520 Amino sugar and nucleotide sugar metabolism
    ABC1148
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.37  xylan 1,4-beta-xylosidase
     ABC1148
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     ABC1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254230..1255801
Genome map
AA seq 523 aa AA seqDB search
MEPFNNPIIPGFYPDPSICRVNEDYYLVTSTFEYFPGVPIFHSTDLVNWRQIGHVLDRPE
QLNLDGTPNSRGIYAPTIRYNNGLFYMITTFVESQHGARRNFFVTAKDPAGPWSDPVWIK
GAPGIDPSLFFDDDGRVYYTGNRVPPTGQTHAKHMEIWLQEIDPITGCLLGEPTGIWDGA
LKIAHAQEAPHLYKKDGYYYLFIAEGGTGFTHAVTVARSREIAGPYEANRRNPVLTHRHL
GQDYPITNVGHADIVQTQDDEWWLVCLGSRPYGGMYRNMGRETFLAPMRWEDDWPVVCPE
TGKIEVEMPGPSLPRQKVEPLPVRDDFNARKLGFQWNMIRTPRTPFYSLEARKGYLQLNV
RPETLADQANPSFIGRRQQHRSFTVRAFMEFDPKQSGEAAGLALFYSQKNHYRFELIRSG
QLFIRLVKVEDGVETVAGKSTAPIPATAIEWQVAADLQELSFSYRVPGGKWRMVANKQDS
RLLSTDRAGGFVGTYIGMFATSNGQNSTTTAAFDWFEYKGEST
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccgtttaacaatccgatcattccgggattttatcctgacccgtcgatttgcagg
gtaaacgaagactattatttagtcacgtctacatttgagtattttcccggtgtgccgatt
tttcattcaaccgatcttgtcaattggcggcagattggccatgtattagaccgtccagag
cagctcaatcttgatggcaccccgaattcacggggaatttatgcgccgacgatccgttac
aataatggactgttttatatgatcaccacatttgtggaaagccaacacggggcaagacgc
aatttctttgtgacggcaaaagacccggctggaccttggtcagacccagtttggataaag
ggggcgcctgggattgacccatccttgttttttgatgatgatggccgcgtctattacaca
ggcaatcgtgtcccccctacagggcaaacgcacgccaagcatatggaaatttggctccag
gaaatcgatcccattacaggctgcctgcttggcgaaccgactgggatttgggatggtgcg
ctaaaaatagcccatgcccaggaagcaccccatctttataaaaaagacggctactattac
ttgtttattgccgaaggggggactggattcacccatgcggtgacagttgcgcgaagccgg
gagattgccggcccttatgaggcgaatcggcgcaaccccgtgctgacgcaccgccatctc
ggccaggactacccgatcacgaatgtaggccacgccgatatcgtccaaacacaagacgat
gaatggtggcttgtctgtttaggttcccgcccatatgggggcatgtaccgcaatatgggg
cgtgagacgtttttagcgcctatgcgctgggaggacgattggcctgttgtttgtcctgag
acagggaaaatcgaagtcgagatgccaggcccgtctttgccgcggcaaaaggtggaaccc
ttgccggtccgggatgattttaacgctcgcaagctaggctttcaatggaatatgatccgc
acgccgcggacgccgttttattcccttgaagcgaggaaagggtatttacagttaaacgtt
cgcccggaaacacttgctgaccaggcgaatccaagttttatcgggcgccgccagcaacat
cgatcgtttactgtccgcgcttttatggaattcgatcctaagcaaagtggcgaggctgct
ggacttgctttattttacagccagaaaaaccattaccgctttgaacttatacgtagtggg
cagttgtttatacggctcgtaaaagtggaagatggcgtggaaacggtggcaggtaaaagc
acggcgccgattccggcaacggcgattgaatggcaagttgccgccgatttgcaagaactt
tcgttttcataccgtgtgccaggtggcaagtggcgcatggtcgctaataagcaagatagc
aggctattgagcacagatcgagcagggggctttgtcggcacctatattggcatgtttgcg
acaagcaacggacaaaacagcacaacgacagccgcatttgattggtttgaatacaagggg
gaatcgacatga

DBGET integrated database retrieval system