KEGG   Bacillus clausii: ABC1266Help
Entry
ABC1266           CDS       T00228                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bcl  Bacillus clausii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bcl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bcl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1387466..1387951
Genome map
AA seq 161 aa AA seqDB search
MSVYDFSVKTSNGQDVSLSAYKGNVLLIVNTATKCGFASQFAGLEKLYNDYKEKGFYVLG
FPSNQFLNQEPVADEDMEQVCKINFGVTFPLFAKTDVKGKHANPLFNYLKAAKKGMLSEE
IKWNFTKFLVNRKGEVIKRYAPATKPETIEADVIEELKADA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgtgtacgatttttcggttaaaacgagtaacggccaagacgtttcattatcagct
tacaaaggcaatgttttgctcattgtcaataccgcaactaaatgcggctttgcttcacag
tttgcagggcttgaaaagctgtacaatgactataaggaaaaaggcttttatgtgctcggc
tttccaagcaaccaatttttaaaccaggagccggttgccgatgaagacatggaacaggtg
tgtaaaatcaatttcggcgttacgttcccactgtttgcaaaaacagatgtgaaaggcaaa
catgccaacccgttgttcaattatttgaaagcggccaaaaagggaatgttgagcgaagag
attaaatggaacttcacgaaatttctcgtcaaccgaaaaggcgaagtcattaagcgttat
gcgcctgctacaaaaccggaaacgattgaagcagatgtcatcgaagaactgaaggccgat
gcatag

DBGET integrated database retrieval system