KEGG   Bacillus clausii: ABC1318Help
Entry
ABC1318           CDS       T00228                                 

Gene name
gsaB
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bcl  Bacillus clausii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABC1318 (gsaB)
Enzymes [BR:bcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     ABC1318 (gsaB)
Amino acid related enzymes [BR:bcl01007]
 Aminotransferase (transaminase)
  Class III
   ABC1318 (gsaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1435862..1437166)
Genome map
AA seq 434 aa AA seqDB search
MNRKTSESLYQEAQHVIVGGVNSPSRAYKGVGGGTPVFMERGEGAYFYDVDGNRYIDYLA
AYGPIITGHAHPVITKAIQDQAAKGVLFGTPTRLENEFAQELTNAIPSLEKVRFVNSGTE
AVMTTIRVARAYTGKEKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVTAATASEVI
TVPFNDIEAFKEALAHWGSETAAVLVEPIVGNFGIVEPEPGFLEAVNDLAHSAGALVIYD
EVITAFRFMYGGAQDYLNVKPDMTALGKIIGGGLPIGAYGGRMDIMEQVAPLGPAYQAGT
MAGNPASMSAGIACLEVLRTEGVYEKLDELGARLEEGLYLAAAKANVPISINRLKGALTV
YFTDEPVIDYEGAKRSNGDQFSVFFKAMLNEGIHLAPSKYEAWFLTIAHTKNDIDETIEA
AYRSFKTVAAGFYS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcaaaacatcagaatccctttaccaggaagctcaacatgtaattgtaggtggt
gtaaatagcccttctagagcctacaaaggagtgggcggcggcacgcctgttttcatggaa
aggggagaaggtgcctatttttatgatgttgacggcaaccgctatattgattatttagcg
gcatacggccccattatcaccggtcacgcccatccagtcattacaaaagctatacaagac
caggccgccaaaggcgttcttttcggcacgccaactcggcttgaaaatgaatttgcacag
gaactaacaaatgccattccatcccttgaaaaagtacgctttgtaaattcgggaactgaa
gcggtcatgacgacgattcgcgtcgcaagagcgtatacaggcaaagaaaaaatcattaag
tttgctggatgctaccatggccattctgatctcgttctcgtagctgctggatcaggccct
tctacactcggcactccagactcagctggcgttacagctgcaacggcaagtgaagtcatt
accgttccctttaatgacatcgaggcatttaaagaagcgctagcccattggggaagcgaa
acagccgctgtccttgttgaaccaatcgttggcaattttggcattgtcgaacctgagcca
ggctttttagaagctgttaatgaccttgctcatagcgccggcgctctcgtgatctatgat
gaagtcattacggctttccgctttatgtatggaggcgctcaagactacttgaatgtgaag
ccagatatgaccgctctaggaaaaattattggcggcggattgccaattggcgcatacggc
ggacggatggatattatggagcaagtcgctccacttggacccgcctaccaagctgggaca
atggccggaaaccctgcatccatgagcgcaggtattgcttgcctcgaagtcttgcgaaca
gaaggcgtatacgagaaactcgatgaacttggggcacgccttgaagaaggcctttattta
gcggccgcaaaagcgaatgttccgatttcaattaaccggttaaaaggagcgctaaccgtt
tatttcacagatgagcccgtcattgattatgaaggagccaaacgttctaacggcgatcaa
tttagcgtctttttcaaagcgatgctaaacgaaggaattcacttggcaccttccaagtac
gaagcttggtttttaacgattgcccatacaaaaaatgacattgatgaaacaattgaagct
gcgtaccgttcatttaaaacagtcgctgcgggtttctatagctga

DBGET integrated database retrieval system