KEGG   Bacillus clausii: ABC1405Help
Entry
ABC1405           CDS       T00228                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcl  Bacillus clausii
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bcl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519684..1521738
Genome map
AA seq 684 aa AA seqDB search
MINAKKPKIWYGGDYNPDQWDSSIWDEDLRMFKLAGIDVVTLNVFAWAKNQPDENTYDFG
WLDTMMDKLHEDGIGVCLATSTAAHPAWMARKYPDVLQVDFYGRKRKFGGRHNSCPNSPT
YRKYAVRMAEKLAERYKDHPALLIWHINNEYGGAGNCYCDNCETAFREWAKARYGSLDEV
NRAWNTGFWGHTFHSWEDIVLPSGLSEEWTGANGRTETNFQGISLDYMRFHSDSLLECYK
LEYEAVKKHTPSIPVTTNLMGAFKKLDYHKWAKHMDVVSWDNYPRFDTPHSYTGMMHDLM
RGLKHGQPFMLMEQTPSQQNWQPYNSLKRPGVMRLWSYQAAARGADTILFFQLRRSIGAC
EKYHGAVIEHVGHEHTRVFRECAALGQELGQLGDTLLDANVQAKVALLFDWENWWAVEMS
SGPSIDLRYVDEVHKYYDALYRLGISVDVVGVDADFSRYDLVIAPVMYMVKAGIADKLEK
YVHGGGSLITTFFSGIVDENDLVKTGGYPGELRKLLGIWAEEIDALLPSQRNRIVLSDQA
PGLKSEYECGILCDLIHSEGAEVKAVYGNDFYRGMPVLTVNKFGAGQAWYVATSPEASFL
QDWLSQLCSSIGIHPLINDMPVGVETTLRSKEGQSYLFVLNHNENPVNIKLGERAGVELL
SGRTLDGEQEELAGRDVWIIKQKP
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgcgaaaaaaccgaagatttggtacggcggtgattacaatcctgaccaatgg
gattcatcgatttgggatgaagatttacgcatgtttaaactggcgggaatcgacgtggtg
accctcaatgtgtttgcttgggcaaaaaaccaaccggatgagaatacatatgacttcggc
tggcttgatacgatgatggataagctgcatgaagacgggattggcgtctgccttgcgacg
agcacggccgcccatccggcttggatggcgcgcaagtaccctgatgtgctccaagtcgac
ttttacgggcgcaaacgaaagtttggcggacgtcataattcttgtccgaacagcccgact
taccgcaagtatgcagttcgcatggcagaaaagcttgccgagcgttataaagatcatccg
gctttgcttatttggcatattaacaacgagtatggcggggcaggcaattgttactgcgac
aattgtgaaaccgctttccgggaatgggcgaaggcgcgttacggttcccttgatgaagtg
aatcgagcatggaataccggattttgggggcacacgttccatagttgggaagacatcgtt
ttgcctagcggactgagcgaggagtggacaggtgcgaacgggcggacggagacgaatttc
caaggaatctccctcgactatatgcgcttccattccgacagtttgctcgaatgttacaag
ctggaatacgaagcagtcaaaaagcatacgccgtccattcctgtcacgacgaatctgatg
ggcgcctttaaaaaactggactaccataaatgggcaaagcatatggatgtcgtatcatgg
gacaattatccacggttcgatacgcctcacagttacacggggatgatgcacgacttgatg
cgcggtttgaagcacggacagccgttcatgctgatggaacagacgccaagccagcaaaat
tggcagccgtacaactcgcttaaacgtcctggtgtcatgaggctatggagttaccaagca
gcggcgcggggagctgatacgattctgtttttccagcttcgccggtcaattggcgcctgc
gagaaatatcacggtgccgtgatcgagcatgtcggccatgagcatacgcgcgtctttcga
gaatgtgccgcgctcgggcaggaactcggccagcttggcgatacgcttctcgatgctaac
gttcaggcgaaagtcgcattgctgtttgattgggagaactggtgggcggtcgaaatgtcc
agcggcccgtcgatcgatcttcgctatgtggacgaagtgcataaatattatgatgccctt
taccgtttaggcatctcggtagacgtcgtcggcgtcgatgccgatttcagtaggtatgat
cttgtcattgccccagtgatgtatatggtgaaagcaggtatagctgacaagctagaaaaa
tatgtacatggcggcggctccctcatcacaaccttcttcagtggcatcgtcgatgaaaat
gatcttgtcaaaacaggcggatatcctggcgaacttcggaaactgcttggcatatgggcg
gaggaaattgacgccttgcttccgagtcaacgtaaccgaattgtcctctcagatcaagct
cccggattaaaatcggaatacgagtgcggcattctttgcgacttgattcattcagaagga
gccgaggtcaaagcggtgtacggcaacgatttttaccggggcatgccggttctgactgtg
aacaaatttggggcaggccaagcttggtatgtggcgacaagcccggaagcgtcgttcctg
caagattggttgtctcagctatgctcttccattggcattcatcctcttattaacgatatg
ccggtaggagtggagacgacgcttcgttcaaaggaaggtcaatcgtatctcttcgtactt
aatcataacgagaaccctgtcaacatcaagcttggcgaacgtgctggcgttgagctgctg
agcggccgcacgctagatggtgaacaagaggagcttgcaggccgtgatgtatggattatt
aaacagaaaccataa

DBGET integrated database retrieval system