KEGG   Bacillus clausii: ABC1431Help
Entry
ABC1431           CDS       T00228                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcl  Bacillus clausii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABC1431
   01230 Biosynthesis of amino acids
    ABC1431
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC1431
  Energy metabolism
   00680 Methane metabolism
    ABC1431
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC1431
Enzymes [BR:bcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ABC1431
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ABC1431
  Exosomal proteins of melanoma cells
   ABC1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544161..1544766
Genome map
AA seq 201 aa AA seqDB search
MIPFVSSQRNASYIKGGDHLQTNVYLVRHAHSTYTADELGRPLSEKGIVASENVRRLFAN
KKIDAVLSSPYKRAIQTVECVAAGIGKEVIIKEGFKERRLSVKPMEDFQAAIAKVWEDPT
FFWEGGESNVAAQKRGVQALLNVLEEYEGKSIVIGTHGNIMVLLMNFFNRNYDFLFWKSL
GMPDIYELVFQGKNLINVERI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgtttgtctcaagtcaaaggaatgcgagctacataaagggaggcgatcatttg
caaacgaatgtgtatttagtccgccacgcccattcaacgtacacagcagatgagcttgga
aggccactgtcagaaaaagggattgtcgctagcgagaacgtaagaaggctttttgcaaac
aaaaaaatcgacgctgtcctctcaagtccatataagcgtgcgattcaaacggtagaatgt
gtggctgccggaatcgggaaagaagtaatcataaaagagggctttaaggaacggcgtttg
tctgtaaagccgatggaggactttcaagcagcgattgcaaaagtttgggaagaccctacg
ttcttttgggaagggggagaatcgaacgtagccgctcaaaagcggggcgttcaagcactg
ctaaacgtgttggaagaatatgaagggaagagcattgtcataggaactcacggcaatatc
atggttttactgatgaacttctttaaccggaactatgattttcttttttggaaaagcctt
gggatgcctgatatttatgagctcgtgtttcaaggcaaaaacctaataaatgtggagagg
atttga

DBGET integrated database retrieval system