KEGG   Bacillus clausii: ABC1431Help
Entry
ABC1431           CDS       T00228                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00260  Glycine, serine and threonine metabolism
bcl00680  Methane metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
bcl01230  Biosynthesis of amino acids
Module
bcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcl_M00002  Glycolysis, core module involving three-carbon compounds
bcl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC1431
  Energy metabolism
   00680 Methane metabolism
    ABC1431
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC1431
Enzymes [BR:bcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ABC1431
Membrane trafficking [BR:bcl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ABC1431
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ABC1431
  Exosomal proteins of melanoma cells
   ABC1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAD63966
UniProt: Q5WI39
Position
1544161..1544766
Genome map
AA seq 201 aa AA seqDB search
MIPFVSSQRNASYIKGGDHLQTNVYLVRHAHSTYTADELGRPLSEKGIVASENVRRLFAN
KKIDAVLSSPYKRAIQTVECVAAGIGKEVIIKEGFKERRLSVKPMEDFQAAIAKVWEDPT
FFWEGGESNVAAQKRGVQALLNVLEEYEGKSIVIGTHGNIMVLLMNFFNRNYDFLFWKSL
GMPDIYELVFQGKNLINVERI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgattccgtttgtctcaagtcaaaggaatgcgagctacataaagggaggcgatcatttg
caaacgaatgtgtatttagtccgccacgcccattcaacgtacacagcagatgagcttgga
aggccactgtcagaaaaagggattgtcgctagcgagaacgtaagaaggctttttgcaaac
aaaaaaatcgacgctgtcctctcaagtccatataagcgtgcgattcaaacggtagaatgt
gtggctgccggaatcgggaaagaagtaatcataaaagagggctttaaggaacggcgtttg
tctgtaaagccgatggaggactttcaagcagcgattgcaaaagtttgggaagaccctacg
ttcttttgggaagggggagaatcgaacgtagccgctcaaaagcggggcgttcaagcactg
ctaaacgtgttggaagaatatgaagggaagagcattgtcataggaactcacggcaatatc
atggttttactgatgaacttctttaaccggaactatgattttcttttttggaaaagcctt
gggatgcctgatatttatgagctcgtgtttcaaggcaaaaacctaataaatgtggagagg
atttga

DBGET integrated database retrieval system