KEGG   Bacillus clausii: ABC1554Help
Entry
ABC1554           CDS       T00228                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcl  Bacillus clausii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABC1554 (ruvA)
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABC1554 (ruvA)
DNA repair and recombination proteins [BR:bcl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ABC1554 (ruvA)
    RecFOR pathway proteins
     ABC1554 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1677514..1678113
Genome map
AA seq 199 aa AA seqDB search
MIDYIKGNLVAVEPAYLVVEANGIGFQIYCANPYRFINDLNREVVVPTHHYVREDSQRLF
GFTTRTERLLFEKLLNVSGIGPKGALAILASGEPEDIIHAIEQEDEALLVRFPGVGKKTA
RQIILDLKGKLDDMAPMLEPAAGADKQQKNPQLEDALEALRALGYVEKELKKVEKQLKAE
TLETDEYIRRALALMLKRP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgattgactatattaaagggaatttggttgcagttgaacctgcttatctcgtggtcgaa
gccaacgggattgggttccaaatttactgtgcaaacccttaccgttttataaacgattta
aatcgggaggtagtggtcccgacacaccactatgttcgcgaagacagccaacgcctattt
gggtttacaacaaggacagaacgtttgttgtttgaaaagcttttaaatgtctctggcatt
ggcccaaaaggagcgctcgccattcttgcttctggagaaccagaagatattatccatgca
attgaacaagaagatgaggcgctgcttgtccgtttccctggagtcggcaaaaaaacagca
agacaaatcattcttgacttaaaagggaagcttgatgatatggcaccaatgctggaacct
gctgctggcgctgacaaacagcaaaaaaatccacagcttgaggatgctttagaagcgttg
cgtgctttgggctatgttgaaaaagagctgaaaaaagtggaaaaacagttaaaagcggaa
acgctggaaacagatgaatatattaggcgtgcgcttgcgcttatgttaaaacgtccttaa

DBGET integrated database retrieval system