KEGG   Bacillus clausii: ABC1554Help
Entry
ABC1554           CDS       T00228                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcl  Bacillus clausii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677514..1678113
Genome map
AA seq 199 aa AA seqDB search
MIDYIKGNLVAVEPAYLVVEANGIGFQIYCANPYRFINDLNREVVVPTHHYVREDSQRLF
GFTTRTERLLFEKLLNVSGIGPKGALAILASGEPEDIIHAIEQEDEALLVRFPGVGKKTA
RQIILDLKGKLDDMAPMLEPAAGADKQQKNPQLEDALEALRALGYVEKELKKVEKQLKAE
TLETDEYIRRALALMLKRP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgattgactatattaaagggaatttggttgcagttgaacctgcttatctcgtggtcgaa
gccaacgggattgggttccaaatttactgtgcaaacccttaccgttttataaacgattta
aatcgggaggtagtggtcccgacacaccactatgttcgcgaagacagccaacgcctattt
gggtttacaacaaggacagaacgtttgttgtttgaaaagcttttaaatgtctctggcatt
ggcccaaaaggagcgctcgccattcttgcttctggagaaccagaagatattatccatgca
attgaacaagaagatgaggcgctgcttgtccgtttccctggagtcggcaaaaaaacagca
agacaaatcattcttgacttaaaagggaagcttgatgatatggcaccaatgctggaacct
gctgctggcgctgacaaacagcaaaaaaatccacagcttgaggatgctttagaagcgttg
cgtgctttgggctatgttgaaaaagagctgaaaaaagtggaaaaacagttaaaagcggaa
acgctggaaacagatgaatatattaggcgtgcgcttgcgcttatgttaaaacgtccttaa

DBGET integrated database retrieval system