KEGG   Bacillus clausii: ABC1554Help
Entry
ABC1554           CDS       T00228                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bcl  Bacillus clausii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABC1554 (ruvA)
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABC1554 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677514..1678113
Genome map
AA seq 199 aa AA seqDB search
MIDYIKGNLVAVEPAYLVVEANGIGFQIYCANPYRFINDLNREVVVPTHHYVREDSQRLF
GFTTRTERLLFEKLLNVSGIGPKGALAILASGEPEDIIHAIEQEDEALLVRFPGVGKKTA
RQIILDLKGKLDDMAPMLEPAAGADKQQKNPQLEDALEALRALGYVEKELKKVEKQLKAE
TLETDEYIRRALALMLKRP
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgattgactatattaaagggaatttggttgcagttgaacctgcttatctcgtggtcgaa
gccaacgggattgggttccaaatttactgtgcaaacccttaccgttttataaacgattta
aatcgggaggtagtggtcccgacacaccactatgttcgcgaagacagccaacgcctattt
gggtttacaacaaggacagaacgtttgttgtttgaaaagcttttaaatgtctctggcatt
ggcccaaaaggagcgctcgccattcttgcttctggagaaccagaagatattatccatgca
attgaacaagaagatgaggcgctgcttgtccgtttccctggagtcggcaaaaaaacagca
agacaaatcattcttgacttaaaagggaagcttgatgatatggcaccaatgctggaacct
gctgctggcgctgacaaacagcaaaaaaatccacagcttgaggatgctttagaagcgttg
cgtgctttgggctatgttgaaaaagagctgaaaaaagtggaaaaacagttaaaagcggaa
acgctggaaacagatgaatatattaggcgtgcgcttgcgcttatgttaaaacgtccttaa

DBGET integrated database retrieval system