KEGG   Bacillus clausii: ABC1588Help
Entry
ABC1588           CDS       T00228                                 

Definition
ATP-dependent exoDNAse alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcl  Bacillus clausii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABC1588
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABC1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1712378..1714663
Genome map
AA seq 761 aa AA seqDB search
MDNVGEKTLEKGFVKGKVVHVLFRNEENDYTVAMTRIEKTNEQIEGRKITVVGHLPELEV
EETYLFFGQVAEHPRFGLQYKVETFRRDLPQTKSGIIRFLSSDRFPGVGKKTAEAIVDAL
GERAISAIIEDRTVLNNIPKLKEDTATMLYNQLLEQQGAEQVIIQLSQYGFGTELSMSVY
RTYKLQALDVIRTNPYLLIQDVEGVGFRRADQLGAAIGLTGNHPERLRAGLLYLLRECCM
QQGHLYLQEEALITEGTALLSSPNVQIDASELEAILIEMNEEGMLVREEDRIYMKSLYYA
EKGIATNIRRILSQELTQEFTEADIEKTLGHIEDTHAVTYSNTQKEAIATALRSPLLLLT
GGPGTGKTTVIKGIVEAYAALHGLSLEVAAYKNKSFPLKLTAPTGRASKRMAEATELPAS
TIHSLLGWKGSATGFEKGDHEQLEGELLIVDEMSMVDAWVANQLFKAIPKGMQVVLVGDE
NQLPSVGPGQVLKDLLEADVIPTIQLKDIYRQAEGSSIIELAHSMKDGVLPSDFLTKKAD
RVFFPCQPNQVQQAVWQICENAMKKGYSAKEIQVLAPMYRGQAGINELNTMLQSLFNPAK
EGRRELPFGDVVFRKGDMVLQLVNNPEEGVYNGDRGEIVAVFYAKETTEKKDQLVVSFDG
LEVTYEKKDFSQLTHAYCCSIHKAQGSEFPIVVMPVVSSYMRMLRRNLLYTGITRAKQYL
LLCGDRKTMEQAIKHADEHRHSKLKERLQLLLSRTGNVHRG
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggataatgttggggaaaaaacgctggagaaaggttttgttaaaggaaaagtcgttcat
gtgttgtttcgcaatgaagaaaacgattatacagtggcgatgacgcggattgaaaagacg
aatgaacaaatagaagggcgcaaaataacggttgtcggccatttgcctgaactggaagta
gaggagacctatttatttttcgggcaagtcgctgaacatccacgctttggcctccaatac
aaagtggaaacgtttaggcgcgatttgccacagacgaaaagcggaattattcggtttttg
tcaagcgaccgtttccctggcgttggcaaaaagacagcggaagcaattgtcgacgctctc
ggtgaaagggccatttcagctattattgaagatcgaacggtattaaacaacatcccgaag
ctaaaagaagatacagcgacgatgctctataaccaacttcttgagcaacaaggcgcggag
caagtcattatccaactgtcccaatacgggtttggcacagagttgtcgatgagtgtttac
cgaacgtacaaattgcaagcacttgatgttatccgcaccaacccgtatttgctcattcag
gatgtagaaggagtcggctttcgccgtgcagaccaattaggggcggcgattggcttaact
gggaaccatccagagcgtttgcgggcggggctgctttatttgctccgggaatgttgtatg
caacaaggacatttatacttgcaggaggaagcgctcattacggaggggactgcattatta
tcgagcccaaacgtacaaattgacgcttccgagcttgaggccatcctcatcgaaatgaat
gaagagggcatgctcgttcgtgaagaagaccgcatctacatgaagtcattgtattatgca
gaaaaaggcattgccaccaacatccgccgaattttaagccaagaactgacacaagaattc
actgaagcagacattgaaaaaacactcgggcacattgaggatacacatgctgttacgtat
tcaaacacgcaaaaagaagcgattgccactgctcttcgttctccgctgttgttgctgaca
ggagggcctggaacaggaaagactacggtcattaaaggaattgtggaagcttatgctgcg
cttcatgggctttctcttgaagtggctgcttacaaaaacaaatctttcccccttaagttg
actgcgcccactggtcgagccagcaaacggatggctgaagcaacggaactgcctgcaagc
acgatacacagcttgctcggctggaaaggcagtgcgaccggctttgaaaaaggcgaccat
gaacagcttgaaggggaactgctaattgtcgatgagatgtcgatggtcgatgcctgggtt
gcaaatcagttatttaaagcgattcccaaaggcatgcaagtcgtgttagtaggggatgaa
aaccagttgccttctgtagggcctggccaagtattaaaagaccttttagaagcagacgtt
attccaacaatccaattaaaggacatttacaggcaagctgaaggctcttccatcattgag
cttgcccactcgatgaaagatggcgtgcttccaagtgattttttaacgaaaaaggcagac
cgcgtcttttttccttgccagccgaaccaagtgcaacaagcagtttggcaaatttgtgaa
aacgccatgaagaaaggctacagtgctaaggagatccaagtactggcacccatgtaccgc
gggcaggcagggatcaatgaattaaacacgatgcttcagtccctatttaatccggcaaaa
gaaggtcgcagagagctgccgtttggggatgttgtttttcgcaaaggcgatatggtcctc
cagttagtcaacaatccagaggaaggcgtatacaacggcgatagaggagaaattgttgct
gttttctacgctaaagagacgacggaaaaaaaagatcagctagtggtttcctttgacgga
ctggaagtcacctatgagaaaaaagacttttcacagctaacccatgcctattgctgttct
atccataaagcacaaggaagcgaatttccgattgtggtgatgccagtcgtgtcgagctac
atgcgcatgctgaggcggaacttgctttatacaggcattacccgggccaagcagtatttg
ctcttatgtggcgatcgaaaaacgatggaacaggcgattaaacatgcagacgagcaccgc
cattccaaattaaaggagcgccttcaactattgctttcacgtactggtaacgttcaccgg
ggatag

DBGET integrated database retrieval system