KEGG   Bacillus clausii: ABC1731Help
Entry
ABC1731           CDS       T00228                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bcl  Bacillus clausii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABC1731 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC1731 (glcK)
   00052 Galactose metabolism
    ABC1731 (glcK)
   00500 Starch and sucrose metabolism
    ABC1731 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    ABC1731 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABC1731 (glcK)
   00524 Butirosin and neomycin biosynthesis
    ABC1731 (glcK)
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ABC1731 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1858467..1859447
Genome map
AA seq 326 aa AA seqDB search
MTEDYYAGIDIGGTTVKLAFLTETGELKDKWEIPTDVSENGKHIVDQIAASIQSRLPQHA
TLLGAGVGAPGFIEMKTGFIHHAVNIGWRNYPLREELERVLGVVVRVDNDANLAALGEKW
RGAGDGAEEELFITLGTGVGGGIITRGQILHGSSGMGGEIGHITVIPEGGAPCNCGKTGC
LETVSSATGILRMAKEKLTTNKDSALHRFEEGALTTKDIFDAAKAGDALAKDVVSEATFH
LGFAIANLANALNPSKIIIGGGVSKAKESLLAPLRLVFKQFALPRVSESAEIKLAHLGND
AGIYGAVWLAIQAKATQEEEMLGKSE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggactactatgcaggaattgacattggcggtacgaccgtaaagttggcgttt
cttacggaaacaggcgagttaaaagataaatgggagattcccacagacgtgagcgaaaac
ggcaaacatattgtcgatcaaatcgccgcaagcattcaaagccggctgccgcaacatgca
accttgttaggggctggagtaggtgcaccaggattcattgaaatgaaaactggttttatt
caccatgccgtcaatatcggctggcgaaactatccactaagggaagagcttgaacgcgtc
cttggagtggttgtccgcgtcgacaatgacgctaatttggcagcacttggagagaaatgg
cgcggcgcaggagatggcgctgaagaagagttgtttatcacacttggtacaggtgtcggc
ggtggcattattacaagagggcaaattctccacgggtcaagtggaatgggcggcgaaatt
ggccacataacagttatccctgaaggtggggcaccgtgcaattgcggcaaaacaggctgc
ctggaaacggtatcttcggcaacgggcattttacggatggccaaggaaaagttaacaaca
aataaggacagcgctttgcatcgctttgaagaaggggcgttaacgacaaaagatattttc
gatgctgctaaagctggcgatgcacttgctaaagatgtggtaagtgaagcaacctttcac
cttggttttgcaatagcgaacctggctaatgcgctcaatccaagcaaaatcattattggc
ggtggtgtttctaaagcgaaagaaagcttgcttgctccgcttcgcctcgtatttaagcaa
tttgcgttgccccgtgtttctgagagtgctgagattaaattggctcatttaggcaatgac
gctgggatttacggtgctgtttggcttgctattcaggcaaaagcaacacaggaagaagag
atgttaggaaaaagtgaatga

DBGET integrated database retrieval system