KEGG   Bacillus clausii: ABC1897Help
Entry
ABC1897           CDS       T00228                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcl  Bacillus clausii
Pathway
bcl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01130  Biosynthesis of antibiotics
bcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABC1897 (trpC)
Enzymes [BR:bcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ABC1897 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh NanE His_biosynth Gly_reductase IMPDH
Motif
Other DBs
NCBI-ProteinID: BAD64432
UniProt: Q5WGS3
Position
2014278..2015045
Genome map
AA seq 255 aa AA seqDB search
MLEKILATKREEISQLQLPEKQYFPKKSLKASLQKTSLPLGLIAEIKQASPSKGVLCETI
SPTAIARVYEEGGASAISVLTDRTYFQGDTAYVAEVKKTVSLPVLRKDFILSPLQVEETA
CIGADAMLLIAGAMEAKQLHELYELAYSKGLECLVEVHSEEELESLLAVFTPEVIGINNR
NLKTFQTSVSQTEQIAKMVPKEALLVSESGIHTPDDIARVKKAGANAVLIGEQLMRKDDK
RQAIIDLFSESAINQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagaaaattttggcgacaaaacgagaggaaatcagccaactccagttgcctgaa
aagcagtattttccaaaaaaaagcctgaaagcgtccttacaaaaaacatctttgccacta
gggctaattgcagaaattaaacaggcctccccgtcaaaaggggttttatgtgagacgatt
tcaccaacagcgattgcacgggtttatgaagaaggcggagcaagcgcaattagcgttttg
acagaccgtacgtattttcaaggggacactgcttatgtggctgaagtgaaaaagaccgtg
tctttgccggtattgcggaaggattttattctgtcgccccttcaagtagaggaaacagcg
tgcattggcgcagacgccatgttgttaatagccggtgcaatggaagcgaagcagctccac
gaactatatgaattagcgtatagcaaagggttggagtgtttagttgaagtccatagcgaa
gaagagctagagtcgcttcttgctgtttttaccccagaagtgataggcatcaataatcgc
aatttaaaaacgttccaaacgtcggtttcccaaaccgagcagattgcaaaaatggtgccg
aaagaagcgttgcttgtgtccgagagtggcatccatacacctgatgacattgcgcgtgtg
aagaaagctggagcgaacgctgtgttgattggcgaacagttgatgcgtaaagacgataaa
aggcaagcgatcatcgacttgttttctgaaagtgcgataaaccaatga

DBGET integrated database retrieval system