KEGG   Bacillus clausii: ABC1899Help
Entry
ABC1899           CDS       T00228                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcl  Bacillus clausii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABC1899 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC1899 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABC1899 (trpB)
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABC1899 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2015673..2016872
Genome map
AA seq 399 aa AA seqDB search
MQETIPDSRGRFGEFGGKYVPETLMSAIEELEAGLAKAMVDPAFIGELKADLAEYAGRET
PLTFAKNISAKLGGANIYLKREDLVHTGAHKLNNAIGQGLLAKRMGKNKLVAETGAGQHG
VATATVASRLGMECKVFMGVEDMKRQELNVFRMELLGAEVVPAETGSRTLKDATNEAIRY
WVSHADDTFYLIGSVVGPHPYPKMVRNFQRVIGDEAKQQMAEKTGRLPDTIVACVGGGSN
AIGMFYPFLDDEVELVGVEAAGRGLDTAEHAATISKGSKGIIHGSLTYLLQDESGQIKEP
YSISAGLDYPGVGPEHAYLAAQKRVRYEAVTDKEALDALALLAKEEGIIPAIESAHALAK
AFQMAKTMTPNQSVLVCLSGRGDKDMHTLQRVYKEGYDE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaacaataccagatagccgcggccgttttggcgagtttggcggcaaatatgtt
cccgaaacattaatgtcggcaattgaagagttggaagctgggctggcaaaagcgatggtt
gatcccgcttttataggagagctaaaagccgacttggctgaatatgcaggcagggaaaca
ccgctgacgtttgcgaaaaacattagcgcaaaattaggcggagccaatatctatttaaag
cgggaagatttggttcatacgggggcccataaattgaataatgcaattggccaagggctc
cttgcaaaacgaatgggcaaaaacaagcttgtcgccgaaacaggggcaggccagcacggc
gtcgccacggcaacggttgctagccgccttggcatggaatgcaaagtgtttatgggcgtg
gaagacatgaagcggcaagagttaaatgtatttcgcatggaattacttggcgccgaggtt
gtgccggcggagacggggagccgaacgctaaaagacgctaccaatgaagcgattcgctat
tgggtctcccacgcagatgatacgttttatctaatcggctccgtagtcggcccgcatcct
tatccgaaaatggtccgcaatttccagcgcgtgatcggcgatgaagccaaacagcagatg
gcagaaaagacagggcgactgcctgatacaattgttgcttgtgttggcggtggcagcaac
gcaatcggtatgttttacccgtttctcgacgatgaagtggagcttgtcggcgtcgaagcg
gcaggacgggggcttgatacagccgaacatgctgccacgatcagcaaaggttcgaaagga
attatccacggctcgcttacgtacttgcttcaagatgaatctgggcaaattaaggagcct
tattcgatttccgccggactggattaccctggcgttggccctgagcatgcctacttggcc
gcccaaaagcgagttcgttatgaagctgtaaccgataaggaggcgctcgatgcacttgcg
cttctagccaaagaggaaggaatcattcccgcaattgaatcggctcatgcgttggctaaa
gcttttcaaatggcgaaaacgatgacgccaaaccaatctgtactcgtatgtttatcaggc
agaggcgataaggatatgcacacattgcaacgggtttataaggaggggtacgatgaataa

DBGET integrated database retrieval system