KEGG   Bacillus clausii: ABC1900Help
Entry
ABC1900           CDS       T00228                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcl  Bacillus clausii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABC1900 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC1900 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABC1900 (trpA)
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABC1900 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2016865..2017674
Genome map
AA seq 269 aa AA seqDB search
MNKRLRDAVKKGNLFIPFITAGDPVREATIALALSLQRSGADVLELGIPYSDPLADGPVI
QNASKRALAGGMTLAKAMALVPEMRKEGLTIPVIVFTYANPLLQFGFERFCETACDYGID
GLLVPDLPFEESETLANECEKQGLALISLVAPTSQQRIKAIASRAQGFLYCVSSLGVTGA
RKTLHPQVEAFLKLVKEASPVPFVVGFGISSYEQVEEMGRHADGVVIGSAIVEQIGLRCE
ALKQAESRDEAVKEIEQYVNSLLHPAPTY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcggcttcgtgatgctgtaaaaaagggcaacttgtttattccgttcattacc
gccggagacccggtgcgagaagcaaccatcgccctcgcactctcattacagagaagtggg
gcggatgtgctggagcttggcattccttattctgacccgttggcagatggaccggtcata
caaaacgcctccaaacgtgcactagcaggaggaatgacactggctaaggcgatggcgctc
gtcccggaaatgagaaaagaggggcttacaattcctgttattgtctttacttacgccaac
cctttgctacaatttgggtttgaacgtttttgtgagaccgcatgcgactacggaattgac
ggcctcctcgttcccgatttgccgtttgaagagagcgaaacattggctaatgagtgtgaa
aaacaagggcttgcccttatatcacttgtggcgccaacatctcagcaacggatcaaagcg
attgccagccgcgcccaagggttcctatactgtgtgtcctcgctaggcgtaactggcgcg
agaaaaacacttcatccacaagtagaagcttttttaaagctggtaaaagaagcatcgcct
gtcccgtttgtagttggatttggcatttccagctacgaacaagttgaggaaatggggcgc
catgctgacggtgttgtgatcgggagtgcgattgttgagcaaattggcctcagatgcgag
gcgttaaaacaggcggaatcacgagatgaagcagtcaaagaaattgagcaatatgtcaat
tctcttcttcatcccgctccgacctattaa

DBGET integrated database retrieval system