KEGG   Bacillus clausii: ABC2113Help
Entry
ABC2113           CDS       T00228                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcl  Bacillus clausii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABC2113 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABC2113 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    ABC2113 (odhB)
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABC2113 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2232700..2233962)
Genome map
AA seq 420 aa AA seqDB search
MTEIKVPELGESITEGTISQWLKEVGDYVEQGEFIAELETDKVNAEIPVDTAGVIKEFKR
EPGDTVEIGEVIAIIDESGSAGGSSATSESTKEEATAKEEAPQEEKQAEQTQQPEKEEAV
SNNRPLASPAARKLAREKGISLDAITPTDPTGKIRRQDIEAHQAKPKQTEAPKAQPSSAP
VSEGEAGKPVERQKMSRRRQTIAKRLVDVQHETAMLTTFNEVDMSAVMNLRSRRKDAFSE
KHGVKLGFMSFFTKAVVGALKEFPLLNAEIQGDELLIKKFYDIGIAVSTDSGLVVPVLRD
ADRLSFAGIEKGIGELGKKARDNKLQLADMQGGTFTITNGGVFGSLWSTPILNAPQVGIL
GMHKIQMRPVAIDNERFENRPMMYLALSYDHRIVDGKEAVSFLVKIKQLIEDPEQLLLEG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaaatcaaagtacctgagcttggagaatcgattacagagggcaccatttcccag
tggttgaaagaagtaggcgattatgtcgagcaaggggagtttattgctgaacttgaaaca
gacaaagtcaatgctgaaattcccgtggacacggctggcgtgattaaagaattcaaacgg
gaaccaggcgataccgtagaaattggcgaagtcatcgcgattatcgatgaaagcggctct
gccggcggctcctctgcaacaagcgaaagcacaaaggaagaagccacggcaaaagaggaa
gcaccgcaggaagagaagcaagctgagcaaacgcaacagccagaaaaagaggaagctgtc
agcaacaaccgcccgcttgcctcgccagcagcacggaaattggcgcgtgaaaaaggcatt
tcccttgatgcgattacgccaacggatccaacaggaaaaattcgccgccaagatatcgaa
gcccatcaagcaaaaccaaaacagacagaagcgccgaaagcacagccgtcttctgcacca
gtaagcgaaggggaagcaggcaaacctgttgaacggcaaaaaatgtcacggcgccggcaa
acgattgcaaagcgacttgttgatgttcaacatgaaacagcgatgttgacgacttttaac
gaagtcgatatgagcgcagttatgaatttgcgtagccgccgcaaagatgcattttctgaa
aaacatggtgtgaagttaggatttatgtctttctttacaaaagccgttgttggcgcttta
aaagagtttccgcttctaaatgcggaaattcaaggcgatgagcttctcatcaagaagttt
tatgacattggcattgctgtttcgacagatagcggtctcgttgtccctgtattgcgggat
gccgatcgcctcagctttgctggcattgagaaaggcattggcgaacttggcaaaaaagca
cgggacaataaattgcaactggcagatatgcaaggtggtacatttacgattacgaacggc
ggggtgtttggctccctctggtcaacgccaattttgaacgcgccgcaagtaggcattctc
ggtatgcataaaattcaaatgcgcccagtagcgattgacaacgaacgtttcgaaaatcgg
ccaatgatgtatttggcgctctcttatgaccaccgcattgtcgatggcaaagaagctgtt
agcttcctcgtgaaaattaaacagctgattgaagatcctgaacaattgttgctggaaggc
taa

DBGET integrated database retrieval system