KEGG   Bacillus clausii: ABC2113Help
Entry
ABC2113           CDS       T00228                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcl  Bacillus clausii
Pathway
bcl00020  Citrate cycle (TCA cycle)
bcl00310  Lysine degradation
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
Module
bcl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABC2113 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    ABC2113 (odhB)
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ABC2113 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N LAP1C Presenilin
Motif
Other DBs
NCBI-ProteinID: BAD64648
UniProt: Q5WG57
Position
complement(2232700..2233962)
Genome map
AA seq 420 aa AA seqDB search
MTEIKVPELGESITEGTISQWLKEVGDYVEQGEFIAELETDKVNAEIPVDTAGVIKEFKR
EPGDTVEIGEVIAIIDESGSAGGSSATSESTKEEATAKEEAPQEEKQAEQTQQPEKEEAV
SNNRPLASPAARKLAREKGISLDAITPTDPTGKIRRQDIEAHQAKPKQTEAPKAQPSSAP
VSEGEAGKPVERQKMSRRRQTIAKRLVDVQHETAMLTTFNEVDMSAVMNLRSRRKDAFSE
KHGVKLGFMSFFTKAVVGALKEFPLLNAEIQGDELLIKKFYDIGIAVSTDSGLVVPVLRD
ADRLSFAGIEKGIGELGKKARDNKLQLADMQGGTFTITNGGVFGSLWSTPILNAPQVGIL
GMHKIQMRPVAIDNERFENRPMMYLALSYDHRIVDGKEAVSFLVKIKQLIEDPEQLLLEG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaaatcaaagtacctgagcttggagaatcgattacagagggcaccatttcccag
tggttgaaagaagtaggcgattatgtcgagcaaggggagtttattgctgaacttgaaaca
gacaaagtcaatgctgaaattcccgtggacacggctggcgtgattaaagaattcaaacgg
gaaccaggcgataccgtagaaattggcgaagtcatcgcgattatcgatgaaagcggctct
gccggcggctcctctgcaacaagcgaaagcacaaaggaagaagccacggcaaaagaggaa
gcaccgcaggaagagaagcaagctgagcaaacgcaacagccagaaaaagaggaagctgtc
agcaacaaccgcccgcttgcctcgccagcagcacggaaattggcgcgtgaaaaaggcatt
tcccttgatgcgattacgccaacggatccaacaggaaaaattcgccgccaagatatcgaa
gcccatcaagcaaaaccaaaacagacagaagcgccgaaagcacagccgtcttctgcacca
gtaagcgaaggggaagcaggcaaacctgttgaacggcaaaaaatgtcacggcgccggcaa
acgattgcaaagcgacttgttgatgttcaacatgaaacagcgatgttgacgacttttaac
gaagtcgatatgagcgcagttatgaatttgcgtagccgccgcaaagatgcattttctgaa
aaacatggtgtgaagttaggatttatgtctttctttacaaaagccgttgttggcgcttta
aaagagtttccgcttctaaatgcggaaattcaaggcgatgagcttctcatcaagaagttt
tatgacattggcattgctgtttcgacagatagcggtctcgttgtccctgtattgcgggat
gccgatcgcctcagctttgctggcattgagaaaggcattggcgaacttggcaaaaaagca
cgggacaataaattgcaactggcagatatgcaaggtggtacatttacgattacgaacggc
ggggtgtttggctccctctggtcaacgccaattttgaacgcgccgcaagtaggcattctc
ggtatgcataaaattcaaatgcgcccagtagcgattgacaacgaacgtttcgaaaatcgg
ccaatgatgtatttggcgctctcttatgaccaccgcattgtcgatggcaaagaagctgtt
agcttcctcgtgaaaattaaacagctgattgaagatcctgaacaattgttgctggaaggc
taa

DBGET integrated database retrieval system