KEGG   Bacillus clausii: ABC2174Help
Entry
ABC2174           CDS       T00228                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcl  Bacillus clausii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABC2174
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABC2174
   00630 Glyoxylate and dicarboxylate metabolism
    ABC2174
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABC2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2293848..2296031)
Genome map
AA seq 727 aa AA seqDB search
MTNYVKAGDLQVAQELYEFINTKVIPDSGVTKNDFWSGFANLVKDLVPINKALLAKRDRI
QDQIHAWHRANQSYRFQDYKAFLEEIGYLEPMVDDFQITTEDVDDEIALQAGPQLVVPVN
NARFAINAANARWGSLYDALYGTDAISEEAGADKGNAYNPARGAKVIAYAKQFLDDTIPL
KQGSHKDVVHYSIDDGALAAKRKDGTTTGLKDGTQFTGYQGETAAPSALLFVHHGLHLEI
QIDATHPIGQTDPANVKDIVLESAITTIMDCEDSVTAVDAEDKVLVYANWLGLMKGDLTS
TFVKGDRTIKRTLNSDRAYISPDGSSLTLSGRSLLFVRNVGHLMTTNAVLDKDGQEVPEG
FLDCLVTSLIGKHSLLGNGAYRNSQKGSIYIVKPKMHGSEEVALANELFNRVEDIIGLTR
HTIKIGVMDEERRTSLNLKNCIHAVKERVVFINTGFLDRTGDEIHTSMEAGPMIRKQEMK
SSAWLNGYEQANVAVGLAAGLKGKAQIGKGMWAMPDQMADMLKQKGAQLQAGGNTAWVPS
PTAAVLHAIHYHQINVNAVQQEIASEQSDYRDEMLQIPVAEAPNWSPQEIQEELDNNAQG
ILGYVVRWVEMGIGCSKVPDINNVALMEDRATLRISSQHMMNWLHHGICTKEQVLETLKR
MAKVVDQQNTGDPEYVPMALDYENSVAFQAACDLVFEGYHQPSGYTEPILHRRRKEAKAK
ASVMTRK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattacgtaaaagctggagatttgcaggttgcacaggaactttatgaatttatc
aatacaaaggtgattccagacagcggcgtgacgaagaacgatttctggtctggctttgcc
aatctcgtcaaagaccttgttccgattaacaaagctttattggcgaagcgcgaccgtatt
caagaccagatacatgcctggcatagagcgaatcaatcgtatcgctttcaagattacaaa
gcatttttggaagagattggctacttggagcctatggtggatgattttcaaatcacaact
gaagacgtcgatgacgagattgccctccaagctggaccgcagcttgtcgttcctgtaaac
aacgcacgctttgccattaatgcggcgaatgcccgctgggggagtctatatgatgctttg
tatggaaccgatgcgattagcgaagaagctggtgccgataaaggaaatgcgtacaaccca
gctagaggagcaaaagtcattgcatatgcaaagcaatttctagacgatactattccttta
aagcaaggttcccataaggatgtcgtacactatagcatcgatgacggtgctttagcggca
aagcgaaaagacggaacaacaacagggttgaaggacggtacacagtttaccgggtatcaa
ggcgagacggcagcaccatccgctctgttgttcgtacaccatggccttcatttagagatt
cagattgatgctacacatcctattgggcaaaccgacccagcaaatgtaaaagatattgtg
ctagaatcggccattacgacaattatggattgcgaggactcggtgacggcagttgatgcc
gaagacaaggtgcttgtatatgccaattggctaggcttaatgaaaggcgacttaacgtca
actttcgttaaaggggaccggacgatcaagcgaacattgaattctgaccgagcgtatatt
tccccagacggcagctccctcactttatcaggtcgttcgttactgttcgtccgcaatgtc
ggccacttgatgaccacgaatgccgtccttgataaagacggccaagaggtgccagaaggt
ttcctagattgtctcgttacgagtttaatcggcaagcactccctattgggcaatggagct
tatcgaaactcacaaaagggatcgatttatattgtgaaaccaaaaatgcacggttcagaa
gaagtcgcattagccaatgaactgtttaaccgtgttgaagatatcattggacttacccgc
cataccattaagatcggtgtaatggatgaagaacgccgcacgtcacttaacttaaaaaat
tgcatccatgcggtaaaggaacgagtggtcttcatcaatacaggcttccttgaccgtact
ggcgacgaaattcacacctctatggaagctggcccaatgattcgcaagcaagagatgaaa
tcctccgcttggctcaatggctacgagcaagcaaatgtagcggttggcctcgctgccgga
ttgaagggcaaagcgcaaattggcaaggggatgtgggccatgcctgatcaaatggcagat
atgctcaaacaaaaaggtgctcagctgcaggctggtggcaacacagcctgggtgccttca
cctaccgcagcggttttacacgccatccattatcaccaaatcaatgtgaacgcggttcag
caggagattgcatctgagcaaagcgactatcgagatgaaatgttgcagattccagtcgct
gaagcgccgaattggagtccacaagaaattcaggaagagctcgataataatgcgcaaggc
attcttggatacgtcgtccgttgggtagaaatggggatcggctgctcgaaggtgcctgat
atcaacaacgttgcgctaatggaggaccgtgcgacactgcgcatctctagtcagcatatg
atgaattggcttcatcacggaatctgcacgaaggagcaagtgcttgaaacgttgaaacgc
atggccaaagtggtggatcagcaaaacacaggcgaccccgaatacgttcctatggcgctt
gattatgaaaactctgttgctttccaagcagcatgcgacttggtgttcgaaggctaccat
caaccaagcggttatacagaaccgattcttcatcggcgccggaaagaagcgaaagcgaaa
gccagtgtaatgacgagaaaataa

DBGET integrated database retrieval system