KEGG   Bacillus clausii: ABC2236Help
Entry
ABC2236           CDS       T00228                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bcl  Bacillus clausii
Pathway
bcl00900  Terpenoid backbone biosynthesis
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABC2236 (dxr)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ABC2236 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3 DUF4170
Motif
Other DBs
NCBI-ProteinID: BAD64771
UniProt: Q5WFT4
Position
complement(2366525..2367664)
Genome map
AA seq 379 aa AA seqDB search
MKQISLLGSTGSIGTQTLDVIRDYPDQFTLSALACGTNLELCRNQIKEFQPKLVSVQRPE
DAQTLAGEFGDSIEFLYGEEGLKEVARYSESDIVVTAITGSIGLLPTLSAIKAKKAVAIA
NKETLVSAGHLVVSAAKENDVPLIPVDSEHSAIFQALNGEPKKAVDRLILTASGGSFRDK
SRAELDGVTVEQALAHPNWSMGAKVTIDSATMMNKGLEVIEAKWLFGLDYDQIDVLIHKE
SIIHSMVEYVDRSVIAQLGTPDMRVPIQYALTYPERFARPKHERLDLAELGKLHFEKMDM
ERFRCMKLAYEAGRAGGTMTTVLNAANEVAVCRFLQGEITFLEIERIIEEALSAHSPIAH
PSLEEIQAVDASIRKQLQA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaatcagtttgcttggatcgacagggtcgatcggcacacagacacttgacgtg
atccgtgattatccagatcaatttacgctttcggcgctcgcgtgcggcacaaacttagag
ttatgccgcaaccaaataaaggagttccaaccaaaactcgtctcagtacaacgcccagaa
gacgcacaaacgctagcaggggaattcggtgattctattgaattcttatatggagaagaa
ggcttaaaagaagtggcgcgttatagcgaatctgacatcgtcgtgacagccattactggt
tcgatcgggctgttgccgacgctcagtgcgatcaaggcgaaaaaagcagtcgccattgcc
aataaagaaacacttgtcagtgcgggccaccttgttgtcagtgcggcaaaggaaaacgat
gtgccgctcattcctgtggacagcgagcattctgcgattttccaagcgctgaatggcgaa
ccaaagaaagcggtcgaccgtttgattctgactgcttctggcggcagttttcgcgacaag
agccgggcggagctcgatggcgtgacagtcgaacaagcattggcgcacccgaattggtcc
atgggggcgaaagtgacgatcgattctgctacaatgatgaataaaggcttggaagtgatt
gaggcgaaatggctgtttggtttggattatgaccaaatcgatgtgttgatccacaaagag
agcatcatccactccatggttgaatatgtagaccgcagcgtcattgcccagctaggcact
cccgacatgcgcgtcccaatccaatatgccttaacgtatccagagcgctttgcccgcccg
aaacatgaacgtttagatttagcggagcttggcaaactccacttcgaaaaaatggatatg
gagcgtttccggtgcatgaaactcgcctacgaagcagggcgcgctggtggcacaatgaca
acggtgcttaacgcagccaatgaagtagctgtatgccgctttttgcaaggcgagatcact
ttcttggaaatcgagcgcatcattgaagaggcactaagtgcccattcgccgattgcgcat
ccatcgctcgaagagatccaagctgtcgatgcttcaatccgcaaacagctccaagcataa

DBGET integrated database retrieval system