KEGG   Bacillus clausii: ABC2418Help
Entry
ABC2418           CDS       T00228                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00020  Citrate cycle (TCA cycle)
bcl00620  Pyruvate metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
Module
bcl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC2418 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ABC2418 (pdhC)
   00620 Pyruvate metabolism
    ABC2418 (pdhC)
Enzymes [BR:bcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABC2418 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NQRA HlyD_D23 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAD64953
UniProt: Q5WFA7
Position
complement(2546978..2548255)
Genome map
AA seq 425 aa AA seqDB search
MAYKYKLPEVGEGIHEGEIVKWFVKEGDEVKEDDILLEVQNDKSVVELPSPVDGKVLEVK
VEEGTTSYVGDVILVIDDGSGDDDAEEESKEEAPKEEKQAASEPEKGQSSSEESDEEEGS
RVIAMPSVRKYAREKGIAISKVKGSGKNGRVLKEDVDAFASGGQTEEAAAPKEEEKTASS
KPAATAQAGGNEQLEERVPLKGIRKAIAKAMVNSKHTAPHVTHLDEVDVSALVAHRKQYK
QIAADQGTKLTYLPYVVKALTSALRKYPALNASIDDEAGEIVYKKYFNVGIAADTEQGLV
VPVVKDADRKSIFALADEINELAGKAREGKLSSAEMSGGSATISNLGSARGQWFTPIINH
PEVMILGIGRIEEKPVVKDGEIVVGTMLALSISYDHRLIDGVTAQSALNQIKRLLNDPQL
LLMEG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtggcttataaatataaactgcctgaagtgggtgaaggaattcacgaaggcgaaattgtg
aagtggtttgtaaaagaaggggatgaagtcaaagaggatgacattttgcttgaagtgcaa
aatgacaaatctgtcgttgaacttccttctccagtagatggaaaagtgcttgaagtgaaa
gtggaagaaggcacgacaagctatgttggcgatgtcatcttagtcattgatgatggctct
ggcgatgatgacgctgaagaagaaagcaaagaggaagcgccgaaagaagaaaaacaagca
gcctctgagcctgaaaaaggacaatcttcttctgaagaaagcgatgaagaagaaggttca
cgcgtcattgccatgccttctgtacgcaaatatgcccgtgaaaaaggcattgccatttct
aaagtaaaaggatcaggcaaaaatggccgcgtattaaaagaggatgtagatgcctttgca
tcaggcgggcaaacggaagaagcagcggctccgaaagaagaagaaaagactgcttcctca
aaaccagcagctacagcacaagctggcggaaacgagcagttggaagagcgcgtaccgctt
aaaggcatccgcaaagcgattgcaaaagcaatggtgaactcaaaacatacggctccacac
gtgacacatctcgacgaagtggacgtgtcagcccttgttgcccatcgcaaacagtacaaa
caaattgctgcagaccaaggcacgaaactgacatatcttccatatgtcgtcaaagctttg
acgtccgctcttcgcaaatatccggctttaaatgcgtcaattgatgacgaagcaggcgaa
atcgtctacaaaaagtactttaacgtcggaattgcagcagacactgagcaaggcctcgta
gttcctgtcgtcaaagatgctgaccgtaagtctatttttgcgcttgctgatgaaattaac
gagttggctggaaaagcccgtgaaggcaagctgtcaagtgcagaaatgtcaggtggatcg
gcaacgatctccaaccttggatcagcaagaggacaatggtttacgccaattattaaccac
ccagaagtcatgattttaggcatcggccgtattgaagaaaagcctgttgtaaaagacggc
gaaattgttgtgggcactatgctggcactgtcaattagctatgaccaccgcttgattgat
ggcgtgacagcacaaagcgcgcttaaccaaatcaagcgtttgctaaacgacccacaatta
ctattaatggaggggtaa

DBGET integrated database retrieval system