KEGG   Bacillus clausii: ABC2641Help
Entry
ABC2641           CDS       T00228                                 

Gene name
leuB
Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
bcl  Bacillus clausii
Pathway
bcl00290  Valine, leucine and isoleucine biosynthesis
bcl00660  C5-Branched dibasic acid metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01210  2-Oxocarboxylic acid metabolism
bcl01230  Biosynthesis of amino acids
Module
bcl_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    ABC2641 (leuB)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ABC2641 (leuB)
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     ABC2641 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAD65176
UniProt: Q5WEN4
Position
complement(2768869..2769963)
Genome map
AA seq 364 aa AA seqDB search
MEKQILLLPGDGIGPEIIAETKRVLEEIARLYHHTFQFVEGRIGGDAIDATGSPLPEETL
DLAKGSDAILLGAVGGPKWDGNAPEKRPEKGLLQIRKALGLYANLRPVRVLKPLMGASTL
KEEVLADVDLLIVRELTGGLYFGEPRERRQINGEDGAVDTLLYTRGEIERIVHQAFQFAR
TRKKRVVSVDKANVLESSRLWREIADEVAREYPDVTLSHMLVDNAAMQLIRDPRQFDVIV
TENLFGDILSDEASMITGSLGLLPSASMNTSKVGLFEPVHGSAPDIAGTGAANPLATILS
AAMMLQYSFGLADEAKAIEVAVDRVLAQGVRTKDIAKASENAVSTTAITNAVMEALALKS
ASSR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacaaatattgcttttacctggggacggcattggcccggaaattattgccgaa
accaaacgggtgttagaagaaattgcccggctgtatcaccatacatttcagtttgttgaa
gggcgaattggcggtgatgccattgacgcaactggcagcccccttcctgaggagacgctg
gatcttgccaaaggtagcgacgcaattttgcttggcgcagtcggcggaccaaagtgggac
ggcaatgcccctgaaaaacggccagaaaaaggtttgctgcaaatccgcaaggcactgggc
ctttacgccaaccttcgccctgtccgtgtactgaaaccgttaatgggtgcatccacctta
aaagaggaagtgttggccgacgttgatttgttgattgtacgggagttaacaggcggactt
tattttggcgagccgcgtgaacggcgacaaatcaatggagaagacggggcagtggataca
ctcctttatacaaggggtgaaatcgagcggattgtgcaccaagcgtttcaatttgcaaga
acgcgcaagaaacgggtagtctctgttgacaaggccaatgtcttggaatcgagcaggtta
tggcgggaaattgctgatgaagtagcccgcgagtatccagacgtcacgctttcgcacatg
cttgtcgataatgcggcgatgcagcttattcgtgatccaaggcagtttgacgtcatcgta
acggaaaatttgtttggcgatattttgagtgatgaagcttcgatgattaccggatccttg
ggcttattgccctcggcgagcatgaatacgtcaaaagtcggcttgtttgagcctgtgcac
ggctctgctcctgacatagcagggacgggcgcggccaatccgctagcgacgattttgtca
gcagcgatgatgctgcaatatagttttgggttagcggacgaggcaaaagcaatcgaagtc
gcagtcgaccgtgtgctcgctcaaggagtacggacaaaagacatcgcaaaagcaagcgaa
aacgctgtttcgacaacggcaataacaaatgcggttatggaggcgcttgctctcaaaagt
gcctcaagccgctaa

DBGET integrated database retrieval system