KEGG   Bacillus clausii: ABC2671Help
Entry
ABC2671           CDS       T00228                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcl  Bacillus clausii
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABC2671
  Lipid metabolism
   00071 Fatty acid degradation
    ABC2671
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABC2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2800897..2801667)
Genome map
AA seq 256 aa AA seqDB search
MENITWKVTDGIAEIGLKRPPANALARSVIEELSEVFENVYNDDAIKVAIIYGEGRFFAA
GADIKEFTEVGDSEEFAQLGKKGQDTFNKIEAAPKPVIAAIHGAALGGGLELAMACHIRL
AAPETKLGLPELNLGLIPGFGGTQRLPRLVGQPKALEMMLTSAPITAEEALNVGLVNKVC
DEDHLLEEARAMARTIAAKSPLTVKRVLELTKMSEGALKEGLDKEIAYFSEVYQKEDRIE
GVNAFIEKRKPVFRGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaacataacatggaaagtcacagacggcatcgcagagatcgggttaaagcggccc
cctgccaatgcgcttgcacggtctgtgatcgaagagctgagcgaagtttttgaaaacgta
tacaacgatgatgcaattaaagtggcaatcatttacggagaaggccgtttttttgcggca
ggggcagatattaaagaatttacagaagtaggcgacagcgaagagtttgcccaacttggc
aaaaaagggcaagatacgttcaataaaattgaagcagctccgaagcccgttatcgctgct
atccatggcgccgcgctcggcggcggacttgaactagctatggcttgccatattcgtctg
gcggcaccagagacaaaactgggcttgccagaactgaacctcgggttgatcccaggcttt
ggcgggacgcaaaggttgccacggcttgttggccagccgaaagcgttggaaatgatgctg
acaagcgctcctattacggccgaagaggcgcttaacgttggacttgtgaataaagtgtgc
gatgaagatcatctgctggaggaagcaagggcaatggcaaggacgattgctgcgaagagc
ccgttaacggtcaagcgcgtattggagcttacgaaaatgagcgaaggcgctctgaaggaa
ggcttagataaggagatcgcttatttttctgaagtttatcagaaagaggatcgcatagaa
ggcgtcaatgcttttattgaaaagcgcaagcctgtttttcgcggcaaatag

DBGET integrated database retrieval system