KEGG   Bacillus clausii: ABC2760Help
Entry
ABC2760           CDS       T00228                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00620  Pyruvate metabolism
bcl00640  Propanoate metabolism
bcl00680  Methane metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC2760 (acsA)
   00620 Pyruvate metabolism
    ABC2760 (acsA)
   00640 Propanoate metabolism
    ABC2760 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ABC2760 (acsA)
Enzymes [BR:bcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABC2760 (acsA)
Lipid biosynthesis proteins [BR:bcl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABC2760 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAD65294
UniProt: Q5WEB6
Position
complement(2894408..2896117)
Genome map
AA seq 569 aa AA seqDB search
MKALPAIEGNHNLKNYEEAVQNFDWEDVRKTFSWHKTGKVNLAYEAIDYHAENGKGEQVA
LYYSDARRDESYTFAEMKTFSNKAANVLKEANVKKGDRVFIFMPRTPELYFTLLGAIKIG
AIVGPLFEAFMEGAVRDRLEDSGAKVLITTPTLLERVPFDDLPDLETVLVADETYEDNGP
FLQLNKRLQAAPSDVAIEWVDREDGLILHYTSGSTGKPKGVLHVHEAMVQHYHTAKVVLD
LQPDDIYWCTADPGWVTGTSYGIFAPWLAGVTNVVRGGRFSPTDWYETIQRYKVTVWYSA
PTAFRMLMSAGDELVKQYDLSSLRHVLSVGEPLNPEVVRWGVKVFDKRIHDTWWMTETGA
QMICNYPAMEIRPGSMGKPIPGVEAAIIDDRGNELPPNRMGNLAIKKGWPAMMRAIWNNE
AKYQSYFELDGWYVSGDSAYMDEDGYFWFQGRIDDVIMTAGERVGPFEVESKLVEHPAVA
EAGVIGKPDPVRGEIIKAFIALRQGYEVTDELKEEIRQFVKTGLAAHAAPREMEFRKSLP
KTRSGKIMRRVLKAWELDLPTGDLSTMED
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcttcctgctattgaaggaaaccataacctgaaaaattatgaagaagctgta
caaaactttgactgggaggatgtcagaaaaacgttttcctggcataaaacaggcaaagtc
aaccttgcctatgaagcgattgattatcatgccgagaacggcaaaggcgaacaggttgct
ctttattatagcgatgcgcgccgtgatgaatcctatacatttgcggaaatgaagacgttc
tcaaacaaagcagcgaatgtgctaaaagaagccaacgttaaaaaaggcgaccgtgtcttt
atttttatgccacgcacacctgagctgtattttacgcttcttggcgccataaaaataggg
gcgattgttggcccgttgtttgaagcttttatggaaggggctgtgcgtgaccgtcttgaa
gacagtggcgcaaaagtgcttatcacaacaccgacattactagaacgggtgccgtttgat
gatttgcctgatttagaaacggtgctagtcgctgatgaaacgtatgaagacaatggccct
tttttacagttaaacaagcggcttcaggcagcaccaagtgatgttgcaattgaatgggta
gatcgggaagacgggctcattctccattatacgtctggctcaacgggcaagccaaaaggg
gttcttcatgttcatgaggcgatggtccaacattaccacacggccaaagtcgtcctcgac
ttgcagccagatgacatttactggtgcacggccgaccctggctgggtaacgggaacgtct
tacggtatttttgcgccttggcttgcaggggtaaccaatgtggtgcgcggcggccgcttc
tcaccgactgattggtatgagacgattcagcgctacaaagtaacagtttggtacagcgcg
ccaaccgcatttcgtatgttgatgagcgcaggcgacgaacttgttaaacaatatgatctc
tcgtcactgcgtcatgtcttaagcgttggcgaaccgctcaatcctgaagtggtgcgctgg
ggagtgaaagtctttgacaaacgcattcatgacacgtggtggatgacggaaacaggagcg
caaatgatctgtaactacccggcaatggaaattcgaccaggatcaatgggcaaaccgatt
ccaggcgtcgaggccgccatcattgatgatagaggcaatgaactgccaccgaaccgaatg
ggcaatcttgccattaaaaaaggctggccagcgatgatgcgtgccatttggaacaatgaa
gccaaataccaaagctattttgagcttgacggctggtatgtgtctggcgattctgcttat
atggatgaagatggttacttttggttccaaggtcggattgacgatgtcattatgaccgca
ggtgagcgtgttggtccatttgaggtggaaagcaaactggttgaacacccagccgttgcg
gaagcaggggtcattggcaaacctgaccctgtccgtggagaaattatcaaagcatttatt
gcactgcgccaaggctatgaagtcactgacgaattaaaagaagagattcgccaatttgta
aagacaggactcgcagctcatgcagcaccgcgggaaatggaattccgcaagtcattgcca
aaaacgcgcagcggaaaaattatgcgccgcgtattaaaagcgtgggaattggatttgccg
acaggcgacttatcgacaatggaagattaa

DBGET integrated database retrieval system