KEGG   Bacillus clausii: ABC2890Help
Entry
ABC2890           CDS       T00228                                 

Gene name
dck
Definition
deoxypurine kinase (EC:2.7.1.113)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcl  Bacillus clausii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcl00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcl00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3018599..3019228
Genome map
AA seq 209 aa AA seqDB search
MLHIPNNAIITVAGTVGVGKTTLTHALADELNFKTSFEKVDNNPYLDKFYRDFERWSFHL
QIYFLAERFKEQKRMVEEGGGYIQDRSIYEDTGIFAKMHADKGTMTQTDYQTYTSLFEAM
VMTPYFPRPDVLIYLHGDFDSILDRIQARGREMEKQTPLSYWEEMYNRYETWISSFSACP
VLRLDIREYDLLADQSCIKRIVHELSTYF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgttacatattcctaataatgcgatcataactgtagctggcacagtcggagttggaaaa
acgactttgacgcacgcacttgccgacgagctaaattttaaaacatcctttgaaaaagta
gacaacaacccatacttagacaaattttatcgcgatttcgaacggtggagctttcacttg
caaatttactttttagcggagcgctttaaagagcagaagcgaatggtagaagaaggtggt
ggctatattcaagatcgttcgatctatgaagacacaggcatattcgcgaaaatgcatgcc
gataaaggcacgatgacgcaaaccgattaccaaacttatacaagcttatttgaagcaatg
gtgatgacgccttactttccccgcccggatgtattaatctacttgcatggcgattttgac
tcgattttagaccgtattcaagcacgagggcgcgaaatggaaaaacaaacgcccctttct
tattgggaagaaatgtacaaccgttatgaaacatggatttcttccttttccgcctgtccg
gttttgcgccttgatattcgcgaatacgatttacttgctgaccaatcatgtatcaaacga
attgttcatgagctaagcacttatttctaa

DBGET integrated database retrieval system