KEGG   Bacillus clausii: ABC2890Help
Entry
ABC2890           CDS       T00228                                 

Gene name
dck
Definition
deoxypurine kinase (EC:2.7.1.113)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bcl  Bacillus clausii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABC2890 (dck)
   00240 Pyrimidine metabolism
    ABC2890 (dck)
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     ABC2890 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     ABC2890 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3018599..3019228
Genome map
AA seq 209 aa AA seqDB search
MLHIPNNAIITVAGTVGVGKTTLTHALADELNFKTSFEKVDNNPYLDKFYRDFERWSFHL
QIYFLAERFKEQKRMVEEGGGYIQDRSIYEDTGIFAKMHADKGTMTQTDYQTYTSLFEAM
VMTPYFPRPDVLIYLHGDFDSILDRIQARGREMEKQTPLSYWEEMYNRYETWISSFSACP
VLRLDIREYDLLADQSCIKRIVHELSTYF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgttacatattcctaataatgcgatcataactgtagctggcacagtcggagttggaaaa
acgactttgacgcacgcacttgccgacgagctaaattttaaaacatcctttgaaaaagta
gacaacaacccatacttagacaaattttatcgcgatttcgaacggtggagctttcacttg
caaatttactttttagcggagcgctttaaagagcagaagcgaatggtagaagaaggtggt
ggctatattcaagatcgttcgatctatgaagacacaggcatattcgcgaaaatgcatgcc
gataaaggcacgatgacgcaaaccgattaccaaacttatacaagcttatttgaagcaatg
gtgatgacgccttactttccccgcccggatgtattaatctacttgcatggcgattttgac
tcgattttagaccgtattcaagcacgagggcgcgaaatggaaaaacaaacgcccctttct
tattgggaagaaatgtacaaccgttatgaaacatggatttcttccttttccgcctgtccg
gttttgcgccttgatattcgcgaatacgatttacttgctgaccaatcatgtatcaaacga
attgttcatgagctaagcacttatttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system