KEGG   Bacillus clausii: ABC2941Help
Entry
ABC2941           CDS       T00228                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcl  Bacillus clausii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABC2941 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC2941 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABC2941 (thrC)
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABC2941 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3064719..3065789)
Genome map
AA seq 356 aa AA seqDB search
MAAWAGLLKEYGSYLPITENTPALTLGEGNTPLIKLEHLSEEWGVELYVKYEGANPTGSF
KDRGMVVAVAKAKEEGAQALICASTGNTSAAASAYGARAGLRSIVVIPKGKTALGKVAQA
AMYGAEIIEIEGNFDRALALVRELCETEPIALVNSVNPYRLHGQKTAAFEICDALGAAPD
VLAIPVGNAGNISAYWMGFKEYDELHQTGRPRMHGFEAEGAAAIVKQHVIEHPETIATAI
RIGNPASWKLAVQAANESKGEIDLVTDEEIVEAYREIAKKEGIFAEPGSCASLAGLKKHI
QAGKVAKGSKIVAVLTGNGLKDPTTAIDLSNVQTTTVEDSKTALADYLMATKPAVK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttgggcaggacttttaaaagaatacggctcgtatttgccgattacggaaaac
acgccggcattgacgcttggcgagggcaatacgcctttaattaaactcgaacatttatca
gaagagtggggcgtagagctttatgtgaagtatgaaggggcaaacccgactggctcgttt
aaagacagaggaatggttgttgctgtcgcaaaagcaaaagaagaaggggcgcaggcgctt
atttgcgcctcaacaggcaatacgtctgcggcagcttccgcctacggggcccgcgcgggg
cttcgttcaattgtcgtcattccaaaaggcaaaacggcacttgggaaagtagcccaagcg
gcgatgtacggagcagaaatcattgaaattgaaggaaactttgaccgcgctcttgcgctc
gtaagagaattatgtgaaacggagccaattgcccttgtcaactcggtcaacccatatagg
ctccacggccaaaagacagcagcttttgaaatttgtgatgcgctaggggctgctccagat
gtattggcgatccctgtcggaaatgccggaaacatctctgcttattggatgggctttaaa
gaatacgatgagttgcaccaaacgggccggccgcgtatgcatggatttgaagcggaaggg
gcggcagcgattgtgaagcaacatgtcattgagcacccagagacgattgccactgccatt
cgcatcggcaatccggcgagttggaaattggctgtacaagctgcgaatgagtcaaaaggc
gaaatcgacttagtgacggacgaagaaattgtcgaggcgtaccgggaaatagcgaaaaaa
gaaggcatatttgctgaaccaggttcatgtgcatcattggctggcttaaaaaaacacatt
caagcagggaaagtagcaaagggctccaaaattgtcgccgttctaactggcaatggcttg
aaggacccgacaacagctatagatctttccaatgtgcaaacgacaacggttgaagattca
aaaacagcgttggccgattacttaatggccacaaagccggcggtcaagtaa

DBGET integrated database retrieval system