KEGG   Bacillus clausii: ABC2941Help
Entry
ABC2941           CDS       T00228                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bcl  Bacillus clausii
Pathway
bcl00260  Glycine, serine and threonine metabolism
bcl00750  Vitamin B6 metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01230  Biosynthesis of amino acids
Module
bcl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC2941 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABC2941 (thrC)
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABC2941 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAD65475
UniProt: Q5WDT5
Position
complement(3064719..3065789)
Genome map
AA seq 356 aa AA seqDB search
MAAWAGLLKEYGSYLPITENTPALTLGEGNTPLIKLEHLSEEWGVELYVKYEGANPTGSF
KDRGMVVAVAKAKEEGAQALICASTGNTSAAASAYGARAGLRSIVVIPKGKTALGKVAQA
AMYGAEIIEIEGNFDRALALVRELCETEPIALVNSVNPYRLHGQKTAAFEICDALGAAPD
VLAIPVGNAGNISAYWMGFKEYDELHQTGRPRMHGFEAEGAAAIVKQHVIEHPETIATAI
RIGNPASWKLAVQAANESKGEIDLVTDEEIVEAYREIAKKEGIFAEPGSCASLAGLKKHI
QAGKVAKGSKIVAVLTGNGLKDPTTAIDLSNVQTTTVEDSKTALADYLMATKPAVK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttgggcaggacttttaaaagaatacggctcgtatttgccgattacggaaaac
acgccggcattgacgcttggcgagggcaatacgcctttaattaaactcgaacatttatca
gaagagtggggcgtagagctttatgtgaagtatgaaggggcaaacccgactggctcgttt
aaagacagaggaatggttgttgctgtcgcaaaagcaaaagaagaaggggcgcaggcgctt
atttgcgcctcaacaggcaatacgtctgcggcagcttccgcctacggggcccgcgcgggg
cttcgttcaattgtcgtcattccaaaaggcaaaacggcacttgggaaagtagcccaagcg
gcgatgtacggagcagaaatcattgaaattgaaggaaactttgaccgcgctcttgcgctc
gtaagagaattatgtgaaacggagccaattgcccttgtcaactcggtcaacccatatagg
ctccacggccaaaagacagcagcttttgaaatttgtgatgcgctaggggctgctccagat
gtattggcgatccctgtcggaaatgccggaaacatctctgcttattggatgggctttaaa
gaatacgatgagttgcaccaaacgggccggccgcgtatgcatggatttgaagcggaaggg
gcggcagcgattgtgaagcaacatgtcattgagcacccagagacgattgccactgccatt
cgcatcggcaatccggcgagttggaaattggctgtacaagctgcgaatgagtcaaaaggc
gaaatcgacttagtgacggacgaagaaattgtcgaggcgtaccgggaaatagcgaaaaaa
gaaggcatatttgctgaaccaggttcatgtgcatcattggctggcttaaaaaaacacatt
caagcagggaaagtagcaaagggctccaaaattgtcgccgttctaactggcaatggcttg
aaggacccgacaacagctatagatctttccaatgtgcaaacgacaacggttgaagattca
aaaacagcgttggccgattacttaatggccacaaagccggcggtcaagtaa

DBGET integrated database retrieval system