KEGG   Bacillus clausii: ABC3019Help
Entry
ABC3019           CDS       T00228                                 

Gene name
tpi
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcl  Bacillus clausii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABC3019 (tpi)
   01230 Biosynthesis of amino acids
    ABC3019 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC3019 (tpi)
   00051 Fructose and mannose metabolism
    ABC3019 (tpi)
   00562 Inositol phosphate metabolism
    ABC3019 (tpi)
Enzymes [BR:bcl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABC3019 (tpi)
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABC3019 (tpi)
  Exosomal proteins of bladder cancer cells
   ABC3019 (tpi)
  Exosomal proteins of melanoma cells
   ABC3019 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3140670..3141425)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTIGEAVDFVEAVKANVPAQATVDSVVCAPALFLDRLLQAVKGTELK
IGAQTMHFEDNGAFTGEISPKALSDMGVHYVIIGHSERREMFAETDETVNKKVHAAFAHH
LVPIMCCGETAEEREAGKMEAVVKEQVENGLAGLSEEQVKQTVIAYEPIWAIGTGKSATE
KDANEACAYVRQTVAANFSEEAAEAIRIQYGGSVKPGNIKDYMAQPDIDGALVGGASLDA
DSFLELVGAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaaaatgaataaaacaatcggcgaagctgtt
gattttgtcgaagcagtaaaagcaaacgttcccgcacaggcaacggttgattcggttgtt
tgtgcgccagccttgtttcttgaccgtttgctccaagcggtaaaaggaactgagttaaaa
attggtgctcaaacgatgcattttgaagacaatggcgcatttacaggggagatcagccct
aaagcattgtctgatatgggtgtccattatgtgattatcggccattcagaacggcgagaa
atgtttgccgagacagatgagactgtcaataagaaagtgcatgccgcattcgcccatcat
ttggttccgattatgtgttgcggtgaaacggctgaagagcgtgaagcgggtaagatggaa
gctgttgtaaaagagcaagtagaaaatggccttgctggtttaagcgaagaacaagttaaa
caaacagtaattgcgtacgagcctatttgggcgatcggcacaggcaaatcagcgacagaa
aaagacgcgaatgaagcttgcgcttatgtgcgtcaaacggtggccgctaatttttctgaa
gaagcagctgaggcgattcgcatccagtacggcggcagcgtaaaacctggcaacattaaa
gactacatggcccaacctgacatagatggcgccctcgttggtggagccagcttggacgca
gattcgtttttagaattagtgggggcagcaaaatga

DBGET integrated database retrieval system