KEGG   Bacillus clausii: ABC3019Help
Entry
ABC3019           CDS       T00228                                 

Gene name
tpi
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bcl  Bacillus clausii
Pathway
bcl00010  Glycolysis / Gluconeogenesis
bcl00051  Fructose and mannose metabolism
bcl00562  Inositol phosphate metabolism
bcl01100  Metabolic pathways
bcl01110  Biosynthesis of secondary metabolites
bcl01120  Microbial metabolism in diverse environments
bcl01130  Biosynthesis of antibiotics
bcl01200  Carbon metabolism
bcl01230  Biosynthesis of amino acids
Module
bcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bcl_M00002  Glycolysis, core module involving three-carbon compounds
bcl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC3019 (tpi)
   00051 Fructose and mannose metabolism
    ABC3019 (tpi)
   00562 Inositol phosphate metabolism
    ABC3019 (tpi)
Enzymes [BR:bcl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABC3019 (tpi)
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABC3019 (tpi)
  Exosomal proteins of bladder cancer cells
   ABC3019 (tpi)
  Exosomal proteins of melanoma cells
   ABC3019 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CBP4
Motif
Other DBs
NCBI-ProteinID: BAD65553
UniProt: Q5WDK7
Position
complement(3140670..3141425)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTIGEAVDFVEAVKANVPAQATVDSVVCAPALFLDRLLQAVKGTELK
IGAQTMHFEDNGAFTGEISPKALSDMGVHYVIIGHSERREMFAETDETVNKKVHAAFAHH
LVPIMCCGETAEEREAGKMEAVVKEQVENGLAGLSEEQVKQTVIAYEPIWAIGTGKSATE
KDANEACAYVRQTVAANFSEEAAEAIRIQYGGSVKPGNIKDYMAQPDIDGALVGGASLDA
DSFLELVGAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaaaatgaataaaacaatcggcgaagctgtt
gattttgtcgaagcagtaaaagcaaacgttcccgcacaggcaacggttgattcggttgtt
tgtgcgccagccttgtttcttgaccgtttgctccaagcggtaaaaggaactgagttaaaa
attggtgctcaaacgatgcattttgaagacaatggcgcatttacaggggagatcagccct
aaagcattgtctgatatgggtgtccattatgtgattatcggccattcagaacggcgagaa
atgtttgccgagacagatgagactgtcaataagaaagtgcatgccgcattcgcccatcat
ttggttccgattatgtgttgcggtgaaacggctgaagagcgtgaagcgggtaagatggaa
gctgttgtaaaagagcaagtagaaaatggccttgctggtttaagcgaagaacaagttaaa
caaacagtaattgcgtacgagcctatttgggcgatcggcacaggcaaatcagcgacagaa
aaagacgcgaatgaagcttgcgcttatgtgcgtcaaacggtggccgctaatttttctgaa
gaagcagctgaggcgattcgcatccagtacggcggcagcgtaaaacctggcaacattaaa
gactacatggcccaacctgacatagatggcgccctcgttggtggagccagcttggacgca
gattcgtttttagaattagtgggggcagcaaaatga

DBGET integrated database retrieval system