KEGG   Bacillus clausii: ABC3183Help
Entry
ABC3183           CDS       T00228                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcl  Bacillus clausii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABC3183
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABC3183
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ABC3183
Enzymes [BR:bcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ABC3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3306144..3307274
Genome map
AA seq 376 aa AA seqDB search
MMKQSYVCRSCHTTYPVSRDLWKCLCGGLLDLDKQMPLLEPTAWESGPPTLWRFLDALPF
EKDAKSWQNVTLGEGNTPLLPVSADKPNVYVKVDYLMPTLSFKDRGAAVLIAKALELGAT
SVIADSSGNAGTAVSAYAARAGIACEVFCSNTVSPKKQAQMAAYNAKVHTIAGTREDVAR
AAQQKAANLEEGGFYASHVYNPYFYEGTKTYAYEIYEQLGDAPDTVIIPVGNGTLLLGAY
YGFSELLANRLIGKCPKIVAVQAQQCAPLAHAFATGEPSITPIVGQTTIAEGIAIAAPPR
ATQILEAVRNTGGTFITVSEAQIAKARSALAKQGFDVEPTSAATYAALHVYRHCETETIV
IPLCGSGTKASDHIAK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaagcaatcgtacgtttgccgcagttgccataccacttaccctgtttcgcgtgat
ctttggaagtgcctttgtggcggtctgctcgaccttgacaaacaaatgccattgctcgaa
cctacggcttgggaatctggtcctcctacactatggcgctttttggacgcattgccgttt
gaaaaagacgcgaaaagttggcaaaacgtgactttaggcgaaggcaatacgccgcttcta
cctgtttctgctgataagccgaatgtctatgtaaaagtcgactatttaatgccgacgctc
tcttttaaagaccgtggcgctgctgtcctaatcgcaaaagcgctagaacttggtgccaca
tctgtcattgccgatagcagcggcaatgcagggactgccgtttcggcctatgcagcaaga
gctggcattgcttgcgaagtgttttgcagcaatacggtttccccgaaaaaacaagcacaa
atggcagcatacaatgccaaggtccacaccattgccggtacacgtgaagatgtcgcacgt
gccgcacagcaaaaagccgccaacttagaagaaggcggtttttatgcaagccatgtgtat
aatccctacttttatgaaggcacgaaaacgtatgcgtacgaaatttatgaacagcttggc
gacgcaccagacacagtgattatccctgttggcaatggcacccttttactcggtgcttat
tacggcttttctgagcttttagcgaaccgtctcattggcaaatgcccgaaaatcgtggcc
gtgcaagctcaacaatgcgcccctcttgctcatgcgtttgccacaggagaaccatctatt
acgcctatagtaggccaaacgacgattgctgaagggattgcgatcgctgcaccacctcgt
gcaacgcaaatattagaggcagtccgcaatacgggcggcaccttcataactgttagcgaa
gcacaaatagcgaaagcacgctcggcacttgccaagcaaggttttgatgtggaacctact
agcgccgctacctacgccgcccttcacgtttaccgacactgtgaaacagaaacgatcgtc
atccctttatgtggttctgggacaaaggcaagtgaccacatagcaaaataa

DBGET integrated database retrieval system