KEGG   Bacillus clausii: ABC3362Help
Entry
ABC3362           CDS       T00228                                 

Definition
(GenBank) endoglucanase (EC:3.2.1.4)
Organism
bcl  Bacillus clausii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3487388..3488455)
Genome map
AA seq 355 aa AA seqDB search
MESSAQQFLHQLLSTPSPSGLEAEIQKKWLTYVAPFADACYTDEAGNAIAALNTGAPFNV
LLAGHCDEIGFLVKAIDENGFVYVEKLGGISHKPALGMEVTILGSNGNVTGVFGTNAEHH
GGAGDNFSFDDLFIDCGATSAEEIKTYVQIGDYAVYSHGAMDLLGDRLSARGLDNRSGAF
MVAEILRRLQQKRPQVGVYAVSTVNEETNLGGAYFAAAGIKPNLAIALDVTFATDYPTVN
AKKYGDVKVGGGPVLAKGAPINRNINALLERTAKKAGIDVQYELTPRNTGTDADRMRLTG
EGVPIALVSLPLRYMHAPREVVSKQDMEQEIELLVQFIANLTGKEELRPVVWPAT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttcagcacaacaatttttacatcagttgctatccacgccctccccatcaggg
ctagaagcagaaattcaaaagaaatggcttacctatgttgcgccatttgctgatgcgtgt
tatacggacgaagctggaaatgcaattgccgcgctgaacactggggcgccatttaatgtc
ctgctggcagggcattgcgatgaaattggcttcttagtcaaagcgattgatgaaaatggt
tttgtatacgttgaaaaactagggggaattagccataaaccagcacttggcatggaagtg
acgatacttggcagcaatggcaacgtcacgggcgtgtttggcaccaatgcagaacaccat
ggcggcgcgggcgataacttttcattcgatgaccttttcattgattgcggggctacttcg
gctgaagaaataaaaacctatgtgcaaattggcgattatgccgtctatagccatggggcg
atggatttgcttggtgatcgcttaagcgcaaggggcctggataaccggagcggtgccttt
atggttgccgaaatattgcggcgcctccaacaaaaacgccctcaggtcggcgtgtatgct
gtcagcacagttaacgaggaaaccaatttgggcggtgcttacttcgccgcagcagggatt
aagcctaatctcgccatcgcccttgacgtcacttttgcgacggactatccgacagtgaat
gccaaaaaatacggcgatgtgaaagtcggcggcgggccagtgttggcaaaaggagcgccc
attaatcgcaacatcaatgcgctgcttgaacgtacagccaaaaaggcaggcattgatgtc
caatacgagctgacccctagaaacacaggcaccgatgctgaccgcatgcgcttgacaggc
gagggtgtgccgattgcgctcgtatcgttgccactccgctatatgcacgctccccgtgaa
gtcgtttcgaaacaagatatggaacaagaaattgagttgctggttcagtttattgcaaac
ttaacgggcaaagaagaactgcgcccagtcgtttggccggcaacctag

DBGET integrated database retrieval system