KEGG   Bacillus clausii: ABC3502Help
Entry
ABC3502           CDS       T00228                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcl  Bacillus clausii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABC3502
   01230 Biosynthesis of amino acids
    ABC3502
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABC3502
   00030 Pentose phosphate pathway
    ABC3502
   00051 Fructose and mannose metabolism
    ABC3502
   00052 Galactose metabolism
    ABC3502
  Energy metabolism
   00680 Methane metabolism
    ABC3502
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ABC3502
Protein phosphatases and associated proteins [BR:bcl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ABC3502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3639744..3640748
Genome map
AA seq 334 aa AA seqDB search
MSTVRNIALITSGGDAPGLNGAIAAIAQTPDVNLYFYHGGFDGIIEQDPIAISPTTAREA
VQQGELLCFSGRSTHMLHEAGQKRVLEKLKQDCIDALIVCGGNGSAQGARSLSAGLPVAV
VPMTIDNDIGGSEYTIGHDTAVNAIAESLHRLRQTAANLPGRIFMVETFGGRCGQLPLAA
AVAASADIVLLPEYELNIDKFITEVNARSARGKSVIIVVSEGIYLNKRFSAGDQGVSFAL
ARALEESTGKRVRLSILGYTQRAGDPTSYDCLMAKQMGQCAVDALLNGEKAMLVALKEGR
VKAIPLTAIEQAPTLAKELLQLAFKENQLIQLEG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggtccgtaacattgctttaattacaagcggcggcgatgcgccagggctaaat
ggtgccattgcggcaattgcccaaacgccggatgttaacctttatttctatcatggcgga
tttgacgggatcattgagcaggaccctatcgccatatcaccaacaacagcgagggaggct
gtgcaacagggagagttgttatgtttttctggccgcagcacacatatgctccatgaggcg
ggacaaaagcgtgtcctcgaaaaattaaagcaagactgcatcgacgccctgattgtgtgc
ggtggcaacggctcggcacaaggggcaagatcgttaagcgcaggcttgccagttgccgtt
gtgccaatgacgatcgacaacgacattggcggaagtgaatacacgattggccatgacaca
gcagtcaatgcgattgccgagtcgctccaccggctccgccaaacagcagccaacttgcca
ggccggatttttatggtcgaaacctttggtgggcgctgcggccaacttccacttgctgct
gctgttgctgccagcgcagatatcgtgctccttcctgaatatgagctcaatatagacaag
ttcattacagaagtaaatgcccgctcagcacgaggaaagagcgtcattattgtcgtatct
gaaggcatctatttgaacaagcgtttttctgctggcgaccagggcgtgtcgtttgcactt
gcccgagcgcttgaggaatcaacaggaaagcgagtgcgcctctcaatacttggctacaca
caacgggcaggtgacccgacaagctatgactgcctgatggccaagcagatgggccaatgt
gcggtcgatgcgttgcttaacggtgaaaaggcgatgcttgtggcgttaaaggaagggcgc
gtcaaagccattccccttacagcaattgaacaagcgcctactttggcgaaagagcttctg
caattggcttttaaagaaaaccaactgatccaattggagggataa

DBGET integrated database retrieval system