KEGG   Bacillus clausii: ABC3516Help
Entry
ABC3516           CDS       T00228                                 

Gene name
lacA
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcl  Bacillus clausii
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ABC3516 (lacA)
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ABC3516 (lacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3652256..3654304)
Genome map
AA seq 682 aa AA seqDB search
MKYPPVHPTVEGMMHGGDYNPDQWLHMPEIIEEDFRLMPLAHCNTFSINIFGWSAIEPEE
GVYTFAWLDDIMDRLAEKGYHAILATPSGARPAWLSKAYPEVLRVEADRRRNLHGQRHNH
CLTSPVYRQKVKQINRKLAERYKGHPALKMWHISNEYGGACHCDYCQDAFRAWLKRRYDN
RLDKLNAAWWTGFWSHTYTDWEQIESPAPHGESMIHGHNLDWKRFVTDQTIDFYRNEIEP
LRELTPEIKITTNFMGNYPHMRPFLGLNYRKFADELDVISWDSYPGWHGEKQSTEALASD
VAFVHDIYRSLKGGQPFLLMESTPSLVNWHDVNRAKKPGMHELSSLQAVAHGADAILYFQ
WRKSRGSSEKFHGAVVDHVGHEHTRVFQEVAQLGRTLEQLAPVAGSTVEADVAIIYDWEN
QWAIDDAQATNNIDKGYASQVQSHYRSFWKHGVPVDVVSMNDDISTCKIVVAPMLYMLKP
GVAEQIEAYVKNGGTFIATYWSGIVDETDLCFLGGFPGPLKPVLGVWAEEIDSLYKHETV
PFTWNGDTYEAHSFIERIHLKGAETIAAFQGGSSPTPAVTKNRLGKGTAYYMASANEQRF
YDAFYELLINEHGLASPIAASIPTGVSVQTRTNGEYAYTFFMNFSEYEKRLTLNGEKKTI
HGETINQVTLRPYGWEVVVEAI
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccaccagtacacccaacagtggaagggatgatgcatggcggcgattataat
ccggaccaatggctgcacatgccagaaatcattgaggaagatttccgtttaatgcccctc
gctcattgcaacacgttttcgattaatattttcggctggagcgcgattgagccagaggaa
ggagtctatacgtttgcatggttagatgacattatggaccgtcttgccgaaaaaggttac
catgcgatcctggctacgccaagtggagcgaggccggcatggctgtcgaaagcctatccg
gaagtgctccgtgtcgaagcggacagacggcggaatttgcatggacagcgtcacaatcac
tgtttgacttcccctgtgtaccgtcagaaagtcaagcaaataaaccgcaaattagcagag
cgctacaaaggccatccggctttgaaaatgtggcatatttcgaatgagtatggcggcgct
tgccattgtgactattgccaagacgcatttcgcgcctggctaaagcgccgttacgacaat
cgtttggataagctaaacgcagcttggtggactggtttttggagccatacgtatacagac
tgggaacaaatcgagtcgcctgccccccatggggaatcgatgatccatggccataattta
gactggaagcgatttgttactgaccagacgattgatttttatcgaaatgaaattgagccg
ctccgtgagttgacgcctgaaatcaagatcacaacgaattttatgggcaattacccccat
atgcggccatttcttgggctgaattaccgaaaatttgctgatgaattagatgtgattagc
tgggacagttatccgggctggcacggagaaaagcaatcgaccgaagcacttgcctcagat
gtcgcctttgtccatgatatctaccgctctttaaaaggcgggcagccgtttttgttaatg
gaaagcacgccaagccttgttaactggcatgatgtgaaccgcgccaagaagccaggcatg
catgagttatcatcattgcaggccgttgcccacggggcagatgcgattctctactttcaa
tggcgcaaaagcagaggctcttctgaaaaatttcatggcgccgtcgtagaccatgtcggc
catgaacatacacgcgtttttcaagaagtcgctcaactggggcgaacgctcgaacagttg
gctcccgttgcaggttcgaccgtagaagcagatgtcgcaatcatttatgactgggaaaac
cagtgggcgattgatgatgcccaagcaacgaacaatattgataaaggctatgcgtcccaa
gttcagagccattatcgaagcttttggaaacacggtgttccagtcgatgtcgtctcaatg
aacgatgacatttccacttgcaaaattgtcgttgccccgatgctttacatgctcaaaccg
ggagtggctgagcaaatcgaagcatatgtcaaaaacggcggtacgtttattgctacgtac
tggagcggcattgtagatgaaaccgatctatgtttccttggcggttttcctggcccatta
aagcccgtgcttggcgtttgggctgaagaaattgacagtttgtacaaacatgaaaccgta
ccgttcacgtggaatggcgatacgtacgaggctcattcatttattgaacgaatccatcta
aaaggcgctgaaacaatcgctgcctttcaaggcggcagctcgccaacaccggctgtcacg
aaaaaccgactaggtaagggaacggcttattatatggcgtcggctaacgaacaacgcttc
tatgatgctttttacgagctgctcattaacgaacacgggcttgcctctcctatcgcagct
tctattccgacaggggtcagtgtgcaaacaaggacgaacggcgaatatgcgtatacgttt
ttcatgaactttagcgaatacgaaaagcgtcttacactaaatggagaaaagaagacgatc
cacggggaaacgatcaatcaagtcacgctccgtccatatgggtgggaagtggtggtcgaa
gccatctaa

DBGET integrated database retrieval system