KEGG   Bacillus clausii: ABC3603Help
Entry
ABC3603           CDS       T00228                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcl  Bacillus clausii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABC3603
Enzymes [BR:bcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ABC3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3757537..3758412
Genome map
AA seq 291 aa AA seqDB search
MIAIVGSINIDLVVYTSNMPVPGETVLGDKFRTNPGGKGANQAVAAARLGAAVTMVGRVG
NDPYGKLATENLRNEQVETGYIDVDNAAHTGVAMITVTNNDNSIVVAPGANFSWKREEAG
LYRELLRQSKVLLLQLEVPLPFIEEIAKLGKEEQCTTILNPAPAQQLSPSMLDLVDFITP
NETECQTIFKQPVEQAVRNYPNKLIVTEGKKGATYHDGNRLVRVNGFLAKAVDTTGAGDT
FNGAFAAALASEHPLAEAVSFANAAASLSVEKAGAQSGMPTKKQVVHRLGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgccattgttggaagcatcaacatcgaccttgtcgtttacacaagtaatatgcct
gtgcctggggaaaccgtgctcggcgacaagtttcgaaccaatccaggagggaaaggagcc
aatcaagccgttgctgctgccaggctaggtgctgcggtaacaatggtaggccgggttggc
aatgatccgtatggaaagcttgcgactgagaacttgagaaacgaacaagtggaaacaggc
tacatagacgtggacaacgcggcacataccggcgtggcaatgattactgtcacaaataat
gacaattctattgtggtcgctcctggcgctaattttagctggaagcgcgaggaggcaggg
ctgtaccgggaactgttgcggcaatcaaaagtcctgcttcttcaacttgaagtaccgctg
ccttttattgaagagatcgcaaaacttggcaaggaagaacaatgcaccacaattctaaac
cctgcccccgcccaacagttatcgccgtccatgcttgatctagtcgactttataacgcca
aatgaaacagagtgccaaaccatctttaaacaaccagttgaacaagcggttcggaactat
cccaataagctgattgtgacagaaggaaaaaaaggcgccacctaccatgatggcaaccgt
cttgtccgcgtcaatggatttttagcaaaagctgtcgatacgactggcgctggagacaca
tttaacggtgcctttgctgccgctttggcatccgaacatccattagctgaagcagtgtcc
ttcgccaacgccgctgcctcgctttccgttgaaaaagcaggagcacaatccggcatgcct
acaaaaaagcaagtagtgcatcgcctaggcacctga

DBGET integrated database retrieval system