KEGG   Bacillus clausii: ABC3735Help
Entry
ABC3735           CDS       T00228                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K16838  
urate oxidase / 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:1.7.3.3 4.1.1.97]
Organism
bcl  Bacillus clausii
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABC3735
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    ABC3735
Enzymes [BR:bcl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     ABC3735
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     ABC3735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3892824..3893849)
Genome map
AA seq 341 aa AA seqDB search
MVSLRSVHQTTERVGVEVENKRTMSYGKGNVFAYRTFMEPLSGLQPIPESAFTVRDNTVF
GINVTVEVGGNAFLSSFTDGDNQMVVATDSMKNFIQRHLATFSGRTIEGFIRYVGEAFLT
TYSHIDWVKLTGEAVPFENTTYANGEESSTSSLVYKHSRNERNEASIELVREGNGWQINS
QNSRLLDLQLVKVKDNSFVGFIRDQYTTLPEDSNRPLFIYLNIGWSYETDDDALGEEPAR
YVAGEQVADLASSVFHELTSPSIQHLIYQIGCRMLKRFPQLQEVTFESQNRTWDTVVEDI
PETEGKVYTEPRLPFGFQRFSVTKADLGPQTTSARTEKARL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggtatcgcttagaagcgttcatcaaacaacagaaagggttggtgtagaagtggaaaat
aaacggacaatgtcttatggaaaagggaatgtgtttgcctaccgaacgtttatggaaccg
ttaagcgggcttcagccgatccctgaatcggcatttactgttcgggataacactgttttt
ggcatcaatgtcacagttgaggtcgggggaaacgcttttctgtcgtcttttacagatggg
gacaatcaaatggttgtcgcaaccgattctatgaaaaattttatccaacggcatttagcg
actttttcaggacggaccattgagggctttatccgttatgtcggggaggcttttctaacg
acttacagccacatagactgggtcaagctaacaggcgaagccgtgccttttgaaaatact
acgtatgcaaatggcgaagaatcaagcacaagttcactcgtttataagcactcgcgcaat
gaacgaaacgaagcgtcgattgagctcgttcgcgaaggaaacggctggcaaatcaacagc
cagaatagcagacttcttgacttgcagcttgttaaagtgaaggacaattcatttgtcggc
tttattcgcgatcaatatacaacgttgcccgaagattccaatcgaccgcttttcatttac
ttgaacattggctggtcttacgaaacagacgacgatgcgctaggggaggagcctgcccgt
tatgtagctggagaacaagttgccgatctcgcttcttctgtttttcatgaactgacctcc
ccctcgattcaacacttgatttaccaaatcggctgccgcatgttaaaacgatttcctcag
ctgcaagaagtgacgtttgaatcgcaaaatcgtacttgggacacagtcgtggaagacatt
cccgaaacagaagggaaagtgtatacggagccgcgcttgccatttggctttcaacggttt
tccgttacaaaagcagatctcggccctcaaaccacgtccgctagaaccgagaaagcgcga
ttatga

DBGET integrated database retrieval system