KEGG   Bacillus clausii: ABC3735Help
Entry
ABC3735           CDS       T00228                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bcl  Bacillus clausii
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bcl00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3892824..3893849)
Genome map
AA seq 341 aa AA seqDB search
MVSLRSVHQTTERVGVEVENKRTMSYGKGNVFAYRTFMEPLSGLQPIPESAFTVRDNTVF
GINVTVEVGGNAFLSSFTDGDNQMVVATDSMKNFIQRHLATFSGRTIEGFIRYVGEAFLT
TYSHIDWVKLTGEAVPFENTTYANGEESSTSSLVYKHSRNERNEASIELVREGNGWQINS
QNSRLLDLQLVKVKDNSFVGFIRDQYTTLPEDSNRPLFIYLNIGWSYETDDDALGEEPAR
YVAGEQVADLASSVFHELTSPSIQHLIYQIGCRMLKRFPQLQEVTFESQNRTWDTVVEDI
PETEGKVYTEPRLPFGFQRFSVTKADLGPQTTSARTEKARL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggtatcgcttagaagcgttcatcaaacaacagaaagggttggtgtagaagtggaaaat
aaacggacaatgtcttatggaaaagggaatgtgtttgcctaccgaacgtttatggaaccg
ttaagcgggcttcagccgatccctgaatcggcatttactgttcgggataacactgttttt
ggcatcaatgtcacagttgaggtcgggggaaacgcttttctgtcgtcttttacagatggg
gacaatcaaatggttgtcgcaaccgattctatgaaaaattttatccaacggcatttagcg
actttttcaggacggaccattgagggctttatccgttatgtcggggaggcttttctaacg
acttacagccacatagactgggtcaagctaacaggcgaagccgtgccttttgaaaatact
acgtatgcaaatggcgaagaatcaagcacaagttcactcgtttataagcactcgcgcaat
gaacgaaacgaagcgtcgattgagctcgttcgcgaaggaaacggctggcaaatcaacagc
cagaatagcagacttcttgacttgcagcttgttaaagtgaaggacaattcatttgtcggc
tttattcgcgatcaatatacaacgttgcccgaagattccaatcgaccgcttttcatttac
ttgaacattggctggtcttacgaaacagacgacgatgcgctaggggaggagcctgcccgt
tatgtagctggagaacaagttgccgatctcgcttcttctgtttttcatgaactgacctcc
ccctcgattcaacacttgatttaccaaatcggctgccgcatgttaaaacgatttcctcag
ctgcaagaagtgacgtttgaatcgcaaaatcgtacttgggacacagtcgtggaagacatt
cccgaaacagaagggaaagtgtatacggagccgcgcttgccatttggctttcaacggttt
tccgttacaaaagcagatctcggccctcaaaccacgtccgctagaaccgagaaagcgcga
ttatga

DBGET integrated database retrieval system