KEGG   Bacillus clausii: ABC3736Help
Entry
ABC3736           CDS       T00228                                 

Definition
uricase (EC:1.7.3.3)
Organism
bcl  Bacillus clausii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3893801..3894313)
Genome map
AA seq 170 aa AA seqDB search
MTTLEELNQADCARFTSMLGHLFEHSPWIPKEAWARRPFASICDLHREMVMVVEEATYED
QLSLIQAHPRLAANEKVGASSAAEQQDAGLDVLSKREALAFSRLNDVYDKRFGFPFVEAV
KGKTAQQLYDSLAERINSTKEAEFNRALAEIFQIAWYRLEAFIKQQKGLV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgttggaagagctcaatcaggccgattgcgcccgttttacaagtatgcttggc
cacctttttgaacactcgccttggattcctaaggaggcgtgggctagacggccgtttgcc
tccatttgtgatcttcatcgggaaatggtgatggtggtagaagaagctacttatgaagac
caattaagtttaatccaagcccaccccaggctagcggcgaacgaaaaggtaggcgcttct
tcagcagcagagcagcaagacgcaggtttggacgttcttagcaagagggaagccctcgct
ttttcccgattaaacgatgtttatgacaagcgattcggttttccttttgtggaagctgtg
aagggaaaaacagcacagcaactatacgactctttggcagaacggattaacagcacgaaa
gaggctgaatttaaccgggcgcttgctgaaatttttcaaatcgcgtggtatcgcttagaa
gcgttcatcaaacaacagaaagggttggtgtag

DBGET integrated database retrieval system