KEGG   Bacillus clausii: ABC3952Help
Entry
ABC3952           CDS       T00228                                 

Gene name
phoB
Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bcl  Bacillus clausii
Pathway
Aminobenzoate degradation
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ABC3952 (phoB)
   00790 Folate biosynthesis
    ABC3952 (phoB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ABC3952 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABC3952 (phoB)
Enzymes [BR:bcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ABC3952 (phoB)
Exosome [BR:bcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABC3952 (phoB)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bcl00537]
 Enzymes
  ABC3952 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4109349..4110689)
Genome map
AA seq 446 aa AA seqDB search
MKRSKKLAVAGLVGIVCLGATYTAAFASDSGEVGEEGNQPSSGQAKNVIFLIPDGFSQGY
TNNYRLYKEDGEPIWDERNMLRAFVQTHSANAEVTDSAAAGTALATGEKTNNGMIGVTPA
GQTLPTILDSAKENGKRTGLVATSTITHATPAAFAVSVESRNSYTEIASQMVANDHIDLM
LGGGRTEFVPEDQGGIREDGVDLISEAEEKGFAFVETARQLANWNGEEDRLLGLFAEEAL
SPAANKRTDEPSLGEMTEKAIEFLSKEDNGFFLMVEGSQIDWAGHANDAYYAMTDTAAFE
EAVEAAVDFADENGETLVVMVGDHDTGGMAVHASEEGDPSKLHGVSALGSDMAAEVERNY
SNLKEVLETYTNFEWTEEELDQLKESDSLELAINTAISEKAGVAWSSLDHTGIDVPLYAY
GAGAERFTGTIDNTEVPKIMKAALGI
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttcaaagaaattggcagtggcagggctggttgggatcgtgtgtcttggagcg
acctacacggcggcatttgcatcagacagtggggaagtaggagaagaaggcaatcagcct
agcagtggacaagccaaaaatgtcatctttttaattcctgatggcttttcgcaaggctat
acaaacaattaccgtttatacaaggaagatggcgagcctatttgggacgaacgcaacatg
ctgcgcgccttcgtgcaaacgcactcggcaaatgcagaagtgaccgattccgctgcagca
ggcacagctttagcaaccggggaaaaaacgaataatggcatgatcggcgtaactcctgct
ggacaaacattgccgacaattctcgactcagcgaaagaaaacggcaagcgcacaggactt
gtggctacatcaacgattacacacgcgacgcctgccgcttttgctgttagcgtagagtca
cggaacagttatacagaaatcgcctcacaaatggtcgcaaacgatcatatcgatttaatg
cttggtggtggccggacagagtttgtgcctgaagaccaaggcggtattcgcgaagatggc
gtcgatttaataagcgaagcagaagaaaaagggtttgcatttgtagagacagcgcggcaa
ttagcgaactggaatggtgaagaagaccgcttgcttggcttgtttgctgaagaagcactg
tcgccggcagctaataaacggacggacgagcctagtttaggggagatgactgaaaaagca
attgaattcttgtcaaaagaggacaatgggtttttcttaatggtagaaggcagccaaatt
gactgggctggacacgccaatgacgcctattacgccatgacagatacggccgcttttgaa
gaagcagtcgaagcagcggtcgattttgccgatgagaatggcgagacgcttgtcgtcatg
gtcggcgatcatgatacaggggggatggccgttcacgcatcagaagaaggggatccgtct
aagcttcatggtgtctctgctctagggagcgacatggctgcagaagtcgaacggaattat
agcaacttaaaagaagtgcttgaaacgtacaccaattttgaatggacagaagaagaattg
gatcaactgaaagaaagcgactcactggaattagcgatcaatacggccatcagcgaaaaa
gcaggcgtagcctggtcatcgttagatcatacaggcattgacgtgccactgtacgcttac
ggcgccggggcagaacggtttaccggcacgatcgacaacactgaagtcccgaaaatcatg
aaagcagcgctggggatttaa

DBGET integrated database retrieval system