KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0046Help
Entry
Bcenmc03_0046     CDS       T00669                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bcm  Burkholderia cenocepacia MC0-3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(59311..62337)
Genome map
AA seq 1008 aa AA seqDB search
MRLHFEADLDYQREAIDAVCDLFRGQESYRGDFSVLANAAPGTTAAAQGSLGFAVSEQGV
GNRLSLTDDALARNLADVQLRGGLPPSGLPGSRDFTVEMETGTGKTYVYLRTIFELNRRY
GFTKFVIVVPSIAIKEGVHKTLSITEDHFRALYAGVPYDYFLYDSAKLGQVRHFAASAAI
QIMVMTVAAINKKEINNLYKDSEKTGGEKPIDLIRATRPIVIVDEPQSVDGGLEGRGREA
LAAMAPLCTLRYSATHVDRHHMVYRLDAVDAYERKLVKQIEIASAIVEDAHNKPYVRLVG
VSNRRGAISARVELDVATAAGVKRQIVSATDGDDLERLTKRALYAGLRIGEVHAVKGAEY
VELRHPEGEAFLSLGEAFGDIDTLAVQREMIRRTIREHLDKELRLAERGVKVLSLFFVDS
VERYRRYDENGMPVKGDYALIFEEEYARAARVPAYRALFDGVDVALEVERAHNGYFSIDR
KGGWTDTSESSAAARENAERAYGLIMREKEALLSFDTPLKFIFSHSALKEGWDNPNVFQI
CTLRDIQTERERRQTLGRGLRLAVDQDGERVRDPGVNTLTVIATERYESFAENLQKEIEA
DTGIRFGIVEEHQFAALPVQEDDGPAHALGIEPSRVLWNHLHEQGYVDAQGKVLDRLKDA
LRQSALVLPDAFERLRAPIVATLRKLSGRFAVRNADERRAIALRRDASGKAVVFGEDFRA
LWDRIRHRTVYRVEFDNAKLVRDCTAALRDAPDIARARLQWRKAEIDIGKAGIEAIEVAG
AGTVLLDEGELPLPDLLTELQDRTQLTRRSLATILADSGRLDDFRVNPQQFIAVAADAIN
RCKRLALVAGIAYRKLGERHVHALESFESEALTGYLRNLRPDARKSIHEAVVCETDAERA
FADALEAHDGVKLYAKLPAWFRVQTPLGSYHPDWAVLAEQDGGERLYFVVDTPNADGHVP
SEHERAKLACGEAHFRALVEGDGAARFVRVRQADALFEPAVPTAGAGR
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcatttcgaagcggatctcgactaccagcgcgaggcgatcgacgccgtctgc
gacctgtttcgcggccaggaatcgtatcgcggcgacttcagcgtgctcgcgaacgccgcg
cccggcacgacggccgccgcgcaaggctcgctcggcttcgcggtatcggagcaaggcgtc
ggtaaccggctgtcgctgaccgacgacgcgctcgcgcgcaatctcgccgacgtgcaactg
cgcggcggcctgccgccgtctggcctgcccggctcgcgcgatttcaccgtcgagatggag
accggcaccggcaagacctacgtgtacctgcgcacgatcttcgagctgaaccgccgttac
ggcttcacgaaattcgtgatcgtcgtgccgtcgatcgcgatcaaggaaggcgtgcacaag
acgctctcgatcaccgaggatcacttccgcgcgctgtacgcgggcgtgccgtacgactac
ttcctgtacgactccgcgaagctcggccaggtgcgccatttcgcggcgagcgcggcgatc
cagatcatggtgatgacggtcgccgcgatcaacaagaaagagatcaacaacctctacaag
gacagcgagaagaccggcggcgagaagccgatcgacctgatccgcgcgacgcggccgatc
gtgatcgtcgacgagccgcagagcgtcgacggcggcctcgaagggcgcgggcgcgaagcg
ctcgccgcgatggcgccgctctgcacgctgcgctattcggccacacacgtcgaccgccac
cacatggtgtaccggctcgatgcggtcgacgcgtacgagcgcaagctcgtcaagcagatc
gagatcgcgtcggcgatcgtcgaggatgcacacaacaagccgtacgtgcggctcgtcggc
gtgtcgaaccggcgcggcgcgatcagcgcgcgcgtcgaactcgacgtcgcgacggcggcc
ggcgtgaagcgccagatcgtgtcggccaccgacggcgacgatctcgaacgcctgaccaag
cgcgcgctgtacgcggggctgcggatcggcgaagtgcatgcggtcaagggcgccgaatac
gtggagctgcgccatccggaaggcgaggcgttcctgtcgctcggcgaggcgttcggcgac
atcgacacgctcgccgtgcagcgcgagatgatccgccgcacgatccgcgagcatctcgac
aaggaattgcgcctggccgagcgcggcgtgaaggtgctgtcgctgttcttcgtcgattcg
gtcgagcgctatcgccgctacgacgagaacggcatgccggtgaagggcgactacgcgctg
atcttcgaagaggaatatgcgcgtgcggcgcgcgtgccggcctaccgtgcgctgttcgac
ggcgtcgacgtcgcgctggaagtcgagcgtgcgcacaacggctacttctcgatcgaccgc
aagggcggctggaccgacacgagcgaaagcagcgcggcggcccgcgagaacgcggagcgc
gcatacggcctgatcatgcgcgagaaggaagcgctgctgtcgttcgacacgccgctgaag
ttcatcttctcgcactcggcgctgaaggaaggctgggacaacccgaacgtgttccagatc
tgcacgctgcgcgacattcagaccgagcgcgagcgccgccagacgctcggccgcgggctg
cgcctcgcggtcgatcaggatggcgaacgcgtgcgcgacccgggcgtcaacacgctcacc
gtgatcgcgaccgagcgctacgagtcgttcgcggaaaacctgcagaaggaaatcgaggcc
gatacgggcatccgtttcgggatcgtcgaggaacaccagttcgcggcgctgccggtgcag
gaagacgacggccccgcgcatgcgctcggcatcgagccgtcgcgcgtgctgtggaaccat
ctgcacgagcagggctacgtcgatgcgcagggcaaggtgctcgaccggctgaaggatgcg
ctgcgccagagcgcgctcgtgctgccggatgcattcgagcggctgcgtgcgccgatcgtc
gcgacgctgcgcaagctgtcgggccgcttcgcggtgcgcaatgccgacgagcgccgcgcg
atcgcattgcggcgcgatgcatcgggcaaggccgtcgtgttcggcgaggatttccgcgcg
ctgtgggatcgcatccgccatcgcaccgtgtaccgcgtcgagttcgacaacgcgaagctg
gtgcgcgactgcacggccgcgttgcgtgacgcgccggacatcgcacgggcgcggctgcag
tggcgcaaggccgagatcgacatcggcaaggccggcatcgaggcgatcgaggtggccggc
gccggcaccgtgctgctcgacgaaggcgaattgccgctgcccgacctgctcaccgagctg
caggaccgcacgcagctcacgcgccgttcgctcgcgacgattctcgccgacagcggccgg
ctcgacgatttccgcgtgaatccgcaacagttcatcgcggtcgcggccgatgcgatcaat
cgctgcaagcggctcgcgctggtcgcgggcatcgcgtaccgcaagctcggcgagcgccac
gtgcatgcgctcgaatcgttcgagagcgaggcgctgaccggctatctgcgcaacctgcgg
cccgatgcacgcaagtcgatccacgaagcggtcgtgtgcgagacggacgcagagcgcgcg
ttcgccgatgcgctcgaagcgcacgacggcgtcaagctgtacgcgaagctgccggcgtgg
ttccgcgtgcagacgccgctcggcagctatcacccggactgggccgtgctcgcggaacag
gacggcggcgagcggctgtacttcgtcgtcgatacgccgaatgccgacggccacgtgccg
agcgagcacgagcgcgcgaagctcgcgtgcggggaagcgcatttccgtgcgctggtcgag
ggcgacggcgcggcgcgcttcgtgcgggtcaggcaggccgatgcgttgttcgaacctgcg
gtgccgacggcaggcgcggggcggtga

DBGET integrated database retrieval system