KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0516Help
Entry
Bcenmc03_0516     CDS       T00669                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00071  Fatty acid degradation
bcm00280  Valine, leucine and isoleucine degradation
bcm00281  Geraniol degradation
bcm00310  Lysine degradation
bcm00360  Phenylalanine metabolism
bcm00362  Benzoate degradation
bcm00380  Tryptophan metabolism
bcm00410  beta-Alanine metabolism
bcm00627  Aminobenzoate degradation
bcm00640  Propanoate metabolism
bcm00650  Butanoate metabolism
bcm00903  Limonene and pinene degradation
bcm00930  Caprolactam degradation
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
bcm01212  Fatty acid metabolism
Module
bcm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcenmc03_0516
   00650 Butanoate metabolism
    Bcenmc03_0516
  Lipid metabolism
   00071 Fatty acid degradation
    Bcenmc03_0516
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcenmc03_0516
   00310 Lysine degradation
    Bcenmc03_0516
   00360 Phenylalanine metabolism
    Bcenmc03_0516
   00380 Tryptophan metabolism
    Bcenmc03_0516
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcenmc03_0516
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcenmc03_0516
   00281 Geraniol degradation
    Bcenmc03_0516
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcenmc03_0516
   00627 Aminobenzoate degradation
    Bcenmc03_0516
   00930 Caprolactam degradation
    Bcenmc03_0516
Enzymes [BR:bcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcenmc03_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACA89694
JGI: Bcenmc030516
UniProt: B1JUV8
Position
1:560371..561147
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALKAFDADDDIGAIVVTGSEKA
FAAGADIGMMATYSYMDVYRGDYITRNWETVREIRKPIIAAVSGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMDAAEAERAGLVSRV
LPADKVLEEAIAAAATIAEFSLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacatcctggtggagacccgggggcgtgtcggtctggtcacgctgaac
cgtccgaaggcgctgaatgcgctgaacgatgcgctgatggatgagttgggcgcggcactg
aaggcgttcgatgccgacgacgatatcggtgcgatcgtcgtgaccggcagcgagaaggca
ttcgcggccggcgcggacatcggcatgatggcgacctattcctatatggatgtttatcgg
ggcgactacatcacgcgcaactgggagacggtccgcgagatccgcaaaccgatcattgcc
gcggtttcgggctttgcgctgggcggcggctgtgaactcgcgatgatgtgcgacatcatc
ttcgcggcggacacggccaagttcggtcagccggaaatcaagttgggcgtcatgccgggt
gcgggcggcacgcagcgtctgccgcgcgcggtgtcgaaggcgaaggcgatggacatgtgc
ctgaccgcgcgcttcatggacgccgccgaggccgagcgtgccgggctcgtttcgcgcgtt
ctgccggccgacaaggtgctcgaggaggcgattgccgccgcggcgacgatcgccgagttt
tcgctgccggcggtcatgatggtcaaggagtcggtgaaccgcgcgtacgagacgacgctg
gctgaaggcgttcacttcgagcgccggctgttccattcactgttcgcaaccgaagaccag
aaggaagggatggcggcattcgtcgagaagcggaagccggtgttcaagcaccgctga

DBGET integrated database retrieval system