KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0600Help
Entry
Bcenmc03_0600     CDS       T00669                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bcm  Burkholderia cenocepacia MC0-3
Brite
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bcenmc03_0600
Transfer RNA biogenesis [BR:bcm03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bcenmc03_0600
 Prokaryotic Type
    Bcenmc03_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:658592..659023
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYAREAVPADVAASGLDTIPTASLPRE
AVTTLGLIGAGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTGDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggcacgccgacgggcagtctggtttccgccgcttacgcacgggaggccgtt
ccggccgacgtggctgccagcgggctcgatacgatcccgactgccagtcttccgcgcgag
gccgtgaccacgctgggcctgatcggcgccggcggcccctatccgtacgagaaagacggc
gtcgtattcggcaatcgcgagcgaatcctgccgaaggcgaagcgcggctattaccatgag
tacacggtgccgacgccgcgtgcgcgcaatcgcggcgcgcgccggatcgtctgtggcggg
ccgttgcgccggatcgacaactgttattacacgggcgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system