KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0726Help
Entry
Bcenmc03_0726     CDS       T00669                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcenmc03_0726
Enzymes [BR:bcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bcenmc03_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(802139..802681)
Genome map
AA seq 180 aa AA seqDB search
MTVAYIGLGANLGDARQTLKDAVVCLAQQRTISILGKSSLYRTAPFEAGGDDYYNCVVKL
DTTLSARELLALCQKIEHHFGRERPYRNAPRTLDLDILLFGADSIDEPDLIVPHPRLTDR
AFALVPLVEIEPALDIPARGRADAFLAAVADQRVEKVQTCQCLMQKALAAGEDADKTRCR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcatatatcggactgggggcgaatctcggcgatgcgcgccagaccctgaag
gacgcggtggtgtgcctcgcgcagcagcgcaccatctcgatcctcggcaagtcgagcctg
tatcgcacggcgcctttcgaagcgggcggcgacgactactacaactgcgtcgtcaagctc
gacacgacgctgtcggcccgcgagctgctcgcgctctgccagaagatcgaacatcacttc
ggccgcgagcgcccgtatcgcaatgcaccgcgcacgctcgacctcgacatcctgctgttc
ggcgccgattcgatcgacgaacccgacctgatcgtcccgcacccgcgcctcaccgaccgc
gcattcgcgctcgtgccgctcgtcgagatcgagccggcgctcgacatccccgcgcgcggc
cgtgccgacgcctttctcgccgccgtcgcggatcagcgcgtcgaaaaggtgcaaacctgc
cagtgcctgatgcagaaggcgctcgctgccggcgaagacgccgacaagacccgctgccga
tga

DBGET integrated database retrieval system