KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0838Help
Entry
Bcenmc03_0838     CDS       T00669                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bcm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:930577..931608
Genome map
AA seq 343 aa AA seqDB search
MTTDTTGRAGNPAAAASPDRFRYGFLKGNPQLTKNGELKHLLSIEGLPRSIVNHILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVK
VFHNLDEGLKGVDVIIMLRLQNERMSGALLPSAQEYFKTWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacaccactggccgcgccggcaatcccgcggcggccgcgagccccgaccgg
tttcgctacggtttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaagcac
ctgctgtcgatcgagggcctgccgcgctcgatcgtcaatcacatcctcgataccgccgag
cagttcgtcagcgtgacggaccgtgaagtgaagaaggtgccgctgctgcgcggcaagtcc
gtgttcaacctgttcttcgagaactcgacgcgcacccgcacgaccttcgagattgccgcg
acgcgcctgtcggccgacgtgctgaacctgaacatcaacgcgtcgtcgacgagcaagggc
gaatcgctgctcgacacgatcaacaacctgtcggcgatgcatgccgacctgttcgtcgtg
cgccacgcgtcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgccggcgacggccgtcatgcgcacccgacgcagggcctgctcgacatgtac
acgatccgtcactacaagcgcgacttcacgaagctgcgcgtggcgatcgtcggcgacatc
ctgcattcgcgcgtcgcgcgctccgacatccacgcgctcaccacgctcggcgtgccggaa
gtgcgagcgatcggcccgcgcacgctgctgccgggcggtctcgagcagatgggcgtgaag
gtgttccacaacctcgacgaggggctgaagggcgtcgacgtgatcatcatgctgcgtctg
cagaacgaacggatgagcggcgcgctgctgccgtccgcgcaggagtacttcaagacgtgg
ggcctgacgcccgagcgcctcgcgctcgccgcgcccgacgcgatcgtgatgcatccgggg
ccgatgaaccgcggcgtcgagatcgattcgcaggtcgccgacggtccgcaatcggtgatc
ctcaaccaggtcacgttcggcatcgccgtgcggatggcggtgatgggcatcgtcgccggc
aacagcgactga

DBGET integrated database retrieval system