KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0838Help
Entry
Bcenmc03_0838     CDS       T00669                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00240  Pyrimidine metabolism
bcm00250  Alanine, aspartate and glutamate metabolism
bcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcenmc03_0838
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcenmc03_0838
Enzymes [BR:bcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bcenmc03_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACA90016
JGI: Bcenmc030838
UniProt: B1JWP2
Position
1:930577..931608
Genome map
AA seq 343 aa AA seqDB search
MTTDTTGRAGNPAAAASPDRFRYGFLKGNPQLTKNGELKHLLSIEGLPRSIVNHILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVK
VFHNLDEGLKGVDVIIMLRLQNERMSGALLPSAQEYFKTWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNSD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacaccactggccgcgccggcaatcccgcggcggccgcgagccccgaccgg
tttcgctacggtttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaagcac
ctgctgtcgatcgagggcctgccgcgctcgatcgtcaatcacatcctcgataccgccgag
cagttcgtcagcgtgacggaccgtgaagtgaagaaggtgccgctgctgcgcggcaagtcc
gtgttcaacctgttcttcgagaactcgacgcgcacccgcacgaccttcgagattgccgcg
acgcgcctgtcggccgacgtgctgaacctgaacatcaacgcgtcgtcgacgagcaagggc
gaatcgctgctcgacacgatcaacaacctgtcggcgatgcatgccgacctgttcgtcgtg
cgccacgcgtcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgccggcgacggccgtcatgcgcacccgacgcagggcctgctcgacatgtac
acgatccgtcactacaagcgcgacttcacgaagctgcgcgtggcgatcgtcggcgacatc
ctgcattcgcgcgtcgcgcgctccgacatccacgcgctcaccacgctcggcgtgccggaa
gtgcgagcgatcggcccgcgcacgctgctgccgggcggtctcgagcagatgggcgtgaag
gtgttccacaacctcgacgaggggctgaagggcgtcgacgtgatcatcatgctgcgtctg
cagaacgaacggatgagcggcgcgctgctgccgtccgcgcaggagtacttcaagacgtgg
ggcctgacgcccgagcgcctcgcgctcgccgcgcccgacgcgatcgtgatgcatccgggg
ccgatgaaccgcggcgtcgagatcgattcgcaggtcgccgacggtccgcaatcggtgatc
ctcaaccaggtcacgttcggcatcgccgtgcggatggcggtgatgggcatcgtcgccggc
aacagcgactga

DBGET integrated database retrieval system