KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0863Help
Entry
Bcenmc03_0863     CDS       T00669                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00010  Glycolysis / Gluconeogenesis
bcm00030  Pentose phosphate pathway
bcm00051  Fructose and mannose metabolism
bcm00052  Galactose metabolism
bcm00230  Purine metabolism
bcm00500  Starch and sucrose metabolism
bcm00520  Amino sugar and nucleotide sugar metabolism
bcm00521  Streptomycin biosynthesis
bcm01100  Metabolic pathways
bcm01110  Biosynthesis of secondary metabolites
bcm01120  Microbial metabolism in diverse environments
bcm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_0863
   00030 Pentose phosphate pathway
    Bcenmc03_0863
   00051 Fructose and mannose metabolism
    Bcenmc03_0863
   00052 Galactose metabolism
    Bcenmc03_0863
   00500 Starch and sucrose metabolism
    Bcenmc03_0863
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_0863
  Nucleotide metabolism
   00230 Purine metabolism
    Bcenmc03_0863
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcenmc03_0863
Enzymes [BR:bcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bcenmc03_0863
    5.4.2.8  phosphomannomutase
     Bcenmc03_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACA90041
JGI: Bcenmc030863
UniProt: B1JX22
Position
1:962637..964031
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDVDTARGIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAANVPLALKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFETGSGTYEEIDVADQYIARIVGDVKLARPLKIVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKSKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SALLNSLPDAMSTPELQLWLDEGENFRLIEQLQKEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEAETQEGLKRIQEDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacatccgtggcgtggtcggcaagacgctc
gacgtcgacacggcgcgcgggatcggccgcgcattcggcagcgaagtgcgtgcgcagggc
ggcgatgcggtcgtcgtcgcgcgcgacggccgcctgtccgggccggaactggtcggcgcg
ctggccgacggcctgcgtgcggccggggtcgacgtcgtcgacgtcggcatggtgccgacg
ccggtcggttatttcgcggcgaacgtgccgctggcgctgaagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaacccgcccgactacaacggcttcaagatg
gtcctgcgcggcgccgcgatctacggcgagcagatccaggcgctgtaccgccgcatcgtc
gacgagcggttcgagacgggcagcggcacgtatgaggaaatcgacgtcgcggatcaatac
atcgcgcgcatcgtcggcgacgtgaagctcgcgcggccgctgaagatcgtggtcgacgcc
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgagctc
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccaccaccccgatcccgcccac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgatgcggaactcggcttc
gcgttcgacggcgacggcgatcgcctgggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgcggaagaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgccacctcgcgcagtgggtgaagtcgaagggcggc
gagccgctgatgtggaagacgggtcactcgctcgtgaaggcgaagctgcgcgagaccggt
gcgccgctcgccggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctgtacaccggtgcgcgcctgctcgagattctcgcgaagacggccgatccg
agcgcgctgctcaacagcctgccggacgcgatgagcacgcccgaactgcagctctggctc
gacgaaggcgagaatttccgcctgatcgagcagttgcagaaagaggcgaagttcgacggc
gccgacgaagtcgtgacgatcgacggcctgcgtgtcgagtacccggacggcttcggcctc
gcgcgttcgtcgaacacgacgccggtcgtcgtgatgcgcttcgaggccgagacgcaggaa
gggctcaagcgcatccaggaagacttccgccgcgtgctgacggccgcgaagccggacgtc
aagctgccgttctga

DBGET integrated database retrieval system