KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0863Help
Entry
Bcenmc03_0863     CDS       T00669                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcenmc03_0863
   00030 Pentose phosphate pathway
    Bcenmc03_0863
   00051 Fructose and mannose metabolism
    Bcenmc03_0863
   00052 Galactose metabolism
    Bcenmc03_0863
   00500 Starch and sucrose metabolism
    Bcenmc03_0863
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_0863
  Nucleotide metabolism
   00230 Purine metabolism
    Bcenmc03_0863
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcenmc03_0863
Enzymes [BR:bcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bcenmc03_0863
    5.4.2.8  phosphomannomutase
     Bcenmc03_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:962637..964031
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVVGKTLDVDTARGIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAANVPLALKGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQALYRRIVDERFETGSGTYEEIDVADQYIARIVGDVKLARPLKIVVDA
GNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPDPAHPENLQDVIQALKDTDAELGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRHLAQWVKSKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILAKTADP
SALLNSLPDAMSTPELQLWLDEGENFRLIEQLQKEAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEAETQEGLKRIQEDFRRVLTAAKPDVKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatatgacatccgtggcgtggtcggcaagacgctc
gacgtcgacacggcgcgcgggatcggccgcgcattcggcagcgaagtgcgtgcgcagggc
ggcgatgcggtcgtcgtcgcgcgcgacggccgcctgtccgggccggaactggtcggcgcg
ctggccgacggcctgcgtgcggccggggtcgacgtcgtcgacgtcggcatggtgccgacg
ccggtcggttatttcgcggcgaacgtgccgctggcgctgaagggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaacccgcccgactacaacggcttcaagatg
gtcctgcgcggcgccgcgatctacggcgagcagatccaggcgctgtaccgccgcatcgtc
gacgagcggttcgagacgggcagcggcacgtatgaggaaatcgacgtcgcggatcaatac
atcgcgcgcatcgtcggcgacgtgaagctcgcgcggccgctgaagatcgtggtcgacgcc
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgagctc
gtcgagcgcttcaccgacatcgacggcacgttcccgaaccaccaccccgatcccgcccac
ccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgatgcggaactcggcttc
gcgttcgacggcgacggcgatcgcctgggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgcggaagaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgccacctcgcgcagtgggtgaagtcgaagggcggc
gagccgctgatgtggaagacgggtcactcgctcgtgaaggcgaagctgcgcgagaccggt
gcgccgctcgccggcgaaatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctgtacaccggtgcgcgcctgctcgagattctcgcgaagacggccgatccg
agcgcgctgctcaacagcctgccggacgcgatgagcacgcccgaactgcagctctggctc
gacgaaggcgagaatttccgcctgatcgagcagttgcagaaagaggcgaagttcgacggc
gccgacgaagtcgtgacgatcgacggcctgcgtgtcgagtacccggacggcttcggcctc
gcgcgttcgtcgaacacgacgccggtcgtcgtgatgcgcttcgaggccgagacgcaggaa
gggctcaagcgcatccaggaagacttccgccgcgtgctgacggccgcgaagccggacgtc
aagctgccgttctga

DBGET integrated database retrieval system