KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_0882Help
Entry
Bcenmc03_0882     CDS       T00669                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcm  Burkholderia cenocepacia MC0-3
Brite
Enzymes [BR:bcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bcenmc03_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 MTS PrmA Methyltransf_18 Methyltransf_11 Met_10 Ubie_methyltran Spermine_synth Methyltransf_23 Methyltransf_12 TPMT Methyltr_RsmB-F Methyltransf_32 Eno-Rase_NADH_b DUF938 Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACA90060
JGI: Bcenmc030882
UniProt: B1JX41
Position
1:complement(981715..982371)
Genome map
AA seq 218 aa AA seqDB search
MNIENARFNMIEQQIRPWDVLDLDVLGLLSIVKRENYVPAEYRDLAFADLELPLPGGASK
MLFPRVEARVLQELTVKKHENVLVIGAGSGYLAALFAHRAQHVTAVEIDPTIAKFAEDNL
RNDGVTNAEVVLGDGSRGWAAKAPYDVICVAGGLPVVPQEMLEQLKVGGRLSAFVGGRPV
MKAQIITRIDDKQYRVADVFETYIDHLVNAIEPSRFKF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaacgcgcgtttcaacatgatcgaacagcagatccgtccgtgggacgtg
ctggatctggatgtcctgggcctgctgtcgatcgtcaagcgtgaaaactacgtgccggcc
gaataccgcgatctcgcgttcgccgatctcgaactgccgctgcccggcggcgccagcaag
atgctgttcccgcgcgtcgaagcacgcgtgctgcaggaactgacggtcaagaagcacgaa
aacgtgctcgtgatcggcgcgggctcgggctacctggccgcgctgttcgcgcatcgcgcg
cagcacgtgacggccgtcgagatcgatccgacgatcgcgaagttcgcggaagacaacctg
cgcaacgacggcgtgaccaacgccgaagtcgtgctcggcgacggttcgcgcggctgggcc
gcgaaggcgccgtacgacgtgatctgcgtcgcgggcggcctgccggtcgtgccgcaggaa
atgctcgagcagctgaaggtcggcggccgcctgtcggcgttcgtcggcggccgtccggtg
atgaaggcgcagatcatcacccgcatcgacgacaagcagtaccgcgtcgccgacgtgttc
gaaacgtacatcgaccacttggtcaacgcgatcgagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system