KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1097Help
Entry
Bcenmc03_1097     CDS       T00669                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bcenmc03_1097
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bcenmc03_1097
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bcenmc03_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1201677..1202705
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTTLSRDDARRLAHPNTGGVILFARHFENRAQLTALTDAIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRTLDAILEQDVAPYDWLGLSLAAVIPAHVIYTQVDKRPAGFSRVWLQDIL
RGKLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPDAAEVVLNGLKAR
TSAESVRRLKRMRARGKALKWDKLIAQPEYLQAQALLSSALA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacgaccctgtcgcgcgac
gatgcgcggcgcctcgcgcatccgaataccggcggcgtgatcctgttcgcgcggcacttc
gagaatcgtgcgcaactgaccgcgctgaccgacgcgatccgcgcggtgcgcgaagacatc
ctgatcgccgtcgaccacgaaggcgggcgcgtgcagcggttccgcaccgacggcttcacg
gtgctgcccgcgatgcgccgcctcggcgaactgtgggatcgcgacgtgctcctcgcgacg
aaggtcgcgaccgccgtcggctacatcctggccgccgaattgcgcgcgtgcgggatcgac
atgagcttcacgcccgtgctcgatctcgactacgggcactcgaaggtgatcggcgatcgg
gcgttccatcgcgacccgcgcgtcgtcacgctgctcgcgaagagcctgaatcacgggctg
tcgctcgccggcatggcgaactgcggcaagcattttcccgggcacggcttcgcggaggcc
gattcgcacgtcgcgctgccgaccgacgaccgcacgctcgatgcgatcctcgagcaggac
gtcgcgccgtacgattggctcgggctgtcgcttgccgcggtgattccggcgcatgtgatc
tacacgcaggtcgacaagcggccggccgggttctcgcgcgtgtggctgcaggacatcctg
cgcggcaagctcggcttcacgggcgcgatcttcagcgacgacctgtcgatggaggccgcc
cgcgaaggcggcacgctcacgcaggcggccgacgccgcgctcgccgccggttgcgacatg
gtgctcgtctgcaaccagccggacgcggccgaagtcgtgctgaacgggctgaaggcgcgg
acctcggccgagtcggtgcggcgcctcaagcggatgcgcgcgcgcggcaaggcgctcaag
tgggacaagctgatcgcgcagcccgagtatctgcaggcgcaggcactgctgagcagcgcg
ctggcgtaa

DBGET integrated database retrieval system