KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1187Help
Entry
Bcenmc03_1187     CDS       T00669                                 

Definition
exodeoxyribonuclease V subunit gamma
Orthology
K03583  
exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bcm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1300875..1304213
Genome map
AA seq 1112 aa AA seqDB search
MLHLFYSNRHETLADALLEDLAAFPARNGPWAPQQVIVPSAALRRRLELDIAARNGVCAN
VEFTYLAQWLWAQIGRVLTVPARSPFAPDRLVWRCYRLFAQAADGAPWLASPRLAAYLSA
SDDAMRYELAHRVAAVLDHYLTYRPEWLAAWQAGESVLAGDAAPRGISDAARDDERWQAA
LWRALLAELSDSGTPPAHRFLVEARHLDADAVARADWPESVSVFALPTMPPLHVALLREL
SRWIDVRVYALNPCREFWFDIVTAAHAEALDAAGRRDYQEVGHPLLAEWGRQTQAQLHML
HELTESAASGDASRFVENPAPTWLARVQNAILELQPEVDIGDTPVERGIEVHVCHSLARQ
LEVLHDRLLAWFDADASLQPSDVLVAVADLAAAGPLIDAVFGTAGAGGARVPYRITGLPP
SQANPVARVLLDWLALPERQVGAPELVEWLRVDAVAARYDIDAAALETVQTWLAAAGARR
GLSPRASDDAAVPAPRHTFSDALARLFLGYAMPEGAAPIGAWLPIEAATGSEAELLGRLA
RFTDDLDGFARRLAESHTPRGWSELFADTLARFFDSGAAYADALAGVRDALDAMLAAMTE
GAPDEALPAAVVRAGLAAALDDPARGGVPWGGVTFSSLTSLRGLPYRVVCLLGMDDGVLP
SLARADEFDLMAVLPKLGDRQRRDDERNLFLDLLLAARDRLLIAYTGRSIRDNAPLPPAA
LVDELLDHLAIVTAGPGAAPDAVDAARRAFIVEHPLQPFAAAYFQLGSELVSYDAERATL
ASLLAAEASRGQPREQPFFAQPLPAEPVEPVAFSEFERFWRHPARALLRGRLGIVLTDAQ
AELLDTEPFALDFAGSDALAERVLPLLIEAGEGGVHDHALRIADASPELPGGATGAVWRD
QALGSMTQLASNVRRALADGIERRPFSLLVVPKWPDTEQALFGADDAMLAADAVSAPLEL
HGTLNRLTPAGQVIYRYARPSARDYLSAWLAHLVYCAIEPGGPRRTLWFGSGGAFELTPV
AAPLERLAPLAALFRAGRRMPLRFFPRSAWARVSDGEAKAASVWINERVVSEADDPAIAI
AWRGAHPSLDEPFGTLARLVFEPLVEHLKEVA
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgctccatctcttctattcgaaccgtcacgaaacgctggccgacgcgctgctcgaggat
ctggctgcgttcccggcccgcaacggcccgtgggcgccgcaacaggtcatcgtgccgagc
gcggcgctgcgccgccgtctcgagctcgacatcgccgcgcgcaatggcgtgtgcgcgaac
gtcgagttcacctatctcgcgcagtggctgtgggcgcagatcggccgcgtgctgacggtg
ccggcgcgctcgccgttcgcacccgaccggctcgtgtggcgctgctaccggctgttcgcg
caggcggccgatggtgcgccgtggctcgcgtcgccgcggctcgccgcgtacctgtcggcc
tccgatgatgcgatgcgctacgaactggcccatcgcgtcgcggccgtgctcgatcattac
ctgacctatcgccccgaatggctggccgcgtggcaggccggcgaatcggtgctcgcgggc
gacgccgcgccgcgcgggatcagcgacgccgcgcgcgacgacgagcgctggcaggccgcg
ctgtggcgtgcgctgctcgccgagctgagcgacagcggcacgccgccggcacaccgcttc
ctcgtcgaagcgcgccatctcgatgccgacgcggtcgcgcgcgccgactggcccgaatcg
gtcagcgtgttcgcgctgccgacgatgccgccgctgcacgtcgcgctgttgcgcgaactg
tcgcgctggatcgacgtgcgcgtctacgcgctgaacccgtgccgcgaattctggttcgac
atcgtgaccgccgcgcatgccgaggcgctcgatgcggcagggcggcgcgactatcaggaa
gtcggtcatccgctgctcgccgaatggggccggcagacgcaggcgcaactgcacatgctg
cacgaactgaccgaaagcgccgcgtcaggcgatgcgtcgcgtttcgtcgagaatcccgcg
cccacctggctcgcgcgcgtgcagaacgcgatcctcgaattgcagccggaggtcgacatc
ggcgacacgccggtcgagcgggggatcgaggtgcatgtgtgccacagcctcgctcgccag
ctcgaggtgctgcacgaccggctgcttgcctggttcgacgccgatgcgagcctgcagccg
tccgacgtgcttgtcgcggtcgccgatctcgccgcggccgggccgctgatcgacgcggtg
ttcggcacggccggcgccggcggcgcgcgggtgccgtaccggatcaccggcctgccgccg
tcgcaggcgaacccggtcgcgcgcgtgctgctcgactggctcgcgttgccggaacggcag
gtcggcgcgccggagctggtcgaatggctgcgcgtggatgcggtggccgcgcgctacgac
atcgacgcggccgcgctcgaaaccgtgcagacctggctcgcggccgccggcgcgcggcgc
gggctgtcgccgcgcgcgagcgacgacgcggccgtgcccgcgccgcgccatacgttctcc
gatgcgctcgcgcgcctctttctcggctatgcgatgcccgaaggcgcggcgccgatcggc
gcgtggctgccgatcgaggcggccaccggcagcgaggccgaactgctcggccggctcgca
cgtttcaccgacgatctcgacggcttcgcgcggcggctcgccgagtcgcacacgccgcgc
ggctggagcgaactgtttgccgacacgctcgcgcgcttcttcgattcgggcgctgcgtat
gccgatgcgctggccggcgtgcgcgacgcgctcgacgcgatgctggccgcgatgacggaa
ggtgcgccggacgaggcgttgccggcggccgtcgtgcgcgcggggctcgccgcggcgctc
gacgatccggcccgcggcggggtgccgtggggtggcgtcacgttctcgtcgctgacgagc
ttgcgcgggctgccgtatcgcgtcgtctgcctgctcgggatggacgacggcgtgctgccg
agtctcgcgcgcgcggatgaattcgacctgatggccgtgctgccgaagctgggcgaccgg
cagcgtcgcgacgacgagcgcaatctgtttctcgacctgttgctcgccgcacgcgaccgc
ctgctgatcgcctatacgggccgcagcatccgcgacaatgcgccgttgccgcccgcggcg
ctcgtcgacgaactgctcgatcatctggcgatcgtcacggccgggcccggcgccgcaccg
gatgcggtcgatgccgcgcggcgcgcgttcatcgtcgaacatccgctgcaaccgttcgcg
gccgcgtacttccaactgggcagcgaactcgtttcgtacgatgccgagcgggcgacactc
gcgtcgctgctggccgccgaagcgtcgcgcggccagccgcgcgagcagccgttcttcgcg
cagccgctgccggccgagccggtcgagcccgtcgcgttcagcgagttcgaacgtttctgg
cggcatccggcgcgtgcgttgctgcgcggccggctcggcatcgtgctgaccgacgcgcag
gcggaactgctcgataccgagccattcgcgctggactttgccggtagcgacgcgctggcc
gagcgcgtgctgccgctcctgatcgaagcaggcgagggtggcgtgcacgatcacgcgctg
cgcattgcggacgcgagccccgaactgcccggcggcgcgacgggcgcggtgtggcgcgac
caggcgctcggttcgatgacgcagcttgcgtcgaacgtgcgccgtgcgctggccgatggc
atcgagcggcggccgttctcgctccttgtcgtaccgaagtggcccgacaccgagcaggcg
ctgttcggcgccgacgacgcgatgctggcggccgacgcggtgagcgcgccgctcgaattg
cacggcacgctgaaccggctgacgccggccgggcaggtcatctaccgctatgcgcggccg
agcgcgcgcgactacctgtccgcgtggctcgcgcatctcgtctactgtgcgatcgagccc
ggcggcccgcgccgcacgctgtggttcggcagcggcggtgcgttcgagctgacgcccgtc
gcggcgccgctcgaacggctcgcgccgctggccgcgctgtttcgcgcggggcggcgcatg
ccgctgcggtttttcccgcgcagtgcgtgggcgcgagtatccgacggcgaggccaaggcc
gcgagcgtgtggatcaacgaacgggtcgtgagcgaggccgacgatccggccatcgcgatc
gcatggcgcggcgcgcatccgtcgctcgacgagccgttcggcacgctcgcgcggctcgtg
ttcgagccgctcgtcgagcatctgaaggaggtcgcatga

DBGET integrated database retrieval system