KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_1189Help
Entry
Bcenmc03_1189     CDS       T00669                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcenmc03_1189
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bcenmc03_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1307914..1310235
Genome map
AA seq 773 aa AA seqDB search
MTASDDMLEFTGGLVARLPEPADFGIALAEGFARRIGDLARRAGAPSASARWAARAAFAT
SRATASGHVCVALGALAQRYEAPLDEVRAALAASGVVAFGTLARGDERPLIVDRLDHLYL
SRYFDYERRLADALVAQAGVAAPDEGLSPDRLRDSLARYFGPATGEVDWQRVAAIVALTG
RVTIVSGGPGTGKTTTVVGVLACLLDAHPGLRIALAAPTGKAAQRMQEALHARAGDLPPE
LAARLPDTSYTLHRLLGGGGAAGFRHHRDNPLPYDLIVVDEASMIDVALAAHLLDALAPG
ARLVLLGDKDQLAAVEAGAVFAELSARPAFTAAARTRIAQALGIDEATFVAALPVPDEAA
PAAVPAAHPVASARAPASPSASAPVSRKSVSRPKVDARQASLFDDEPQDDEVSPADIDID
IAPPPPTESAPTDAGAPEGDAPAWIEPDDLAWLDAVELPPFDAGDAALASMTAPVSLLAG
EAPAAAASTGTPAPAPLADCVVWLERNYRFGLDSPIGRLSVAIRRGDVQAALEALPADDS
AAASFHDDAGDTLASSTVERLARRFGAYLDALRDALAAPAPDPLPLFDALNRFRILCATR
SGSRGAEHVNALVAAHVRHAARVPLAVGAHWFTGRPIMVTRNDYALGLFNGDIGIALPDA
HGVLRVWFRRADGTARAVSPAALPPHETAFALTVHKSQGSEFDEAALVLPASFGRVLTRE
LVYTAVTRARTRVQVIGPRRVLAQAVATRTQRDSGLAARVDEALARRRMDVSR
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccgacgacatgctcgaattcaccggcggtctcgtcgcgcggctgcccgag
ccggccgatttcggcatcgcgctcgcggaaggcttcgcacgccgcatcggcgacctcgcg
cgacgtgccggtgcgccgtccgcgtcggcacgctgggcggcgcgcgccgcgttcgcgacg
agccgtgcgaccgcgagcggccatgtgtgcgtcgcgcttggcgcgcttgcgcagcgctac
gaagcgccgctcgacgaggtccgcgccgcgcttgccgcgagcggcgtggtcgcgttcggc
acgctcgcgcgcggcgacgagcggccgctgatcgtcgaccggctcgatcacctgtacctg
tcgcgctatttcgattacgaacggcggcttgccgatgcgctcgtcgcgcaggccggcgtc
gccgcgccggacgaaggcctgtcgcccgaccggctgcgcgacagtctcgcccgttacttc
gggccggccaccggtgaagtcgactggcagcgcgtcgcggcgatcgtcgcgctgaccggc
cgcgtgacgatcgtcagcggcgggccgggcacgggcaagacgacgaccgtcgtcggcgtg
ctggcctgtctgctcgacgcgcacccggggctgcgcatcgcgctggccgcaccgaccggc
aaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgcaggcgatctgccgcccgag
ctcgcggcgcgcctgcccgacacgtcgtacacgctgcatcggctgctgggcggcggcggg
gcggccggcttccggcatcatcgcgacaatccgttgccgtacgatctgatcgtcgtcgac
gaggcgtcgatgatcgacgtcgcgctcgccgcgcatctgctcgacgcgctcgcgccgggc
gcgcggctcgtgttgctgggggacaaggatcaactggcggcggtcgaggccggcgccgta
ttcgcggaactgagcgcgcggccggcgttcaccgccgcggcgcgcacgcgcatcgcgcag
gcgctgggcatcgacgaggcgacgttcgtcgcggcgttgccggtgccggacgaggcggcg
ccggccgcggttccggccgcgcatccggttgcgtccgcacgggctccggcgtcgccatcg
gcatctgcgcctgtttcgcgcaaatcggtgtctcgaccgaaagtcgatgcgcgacaggca
tcgctcttcgacgatgaaccgcaggatgacgaagtgtcgccggccgacattgacatcgac
atcgcgccgccaccgcccaccgagtcggcaccgaccgatgccggcgcaccagagggtgat
gcgcccgcctggatcgagcccgacgacctcgcatggctcgacgcagtcgagctgccgccg
ttcgacgcaggcgatgcggcgcttgcatcgatgacggcgcctgtatcgttattggccggt
gaagcgccggccgcagccgcgtccaccggcacgcccgctccggcgccgctcgcggactgc
gtggtgtggctcgaacgcaattaccgcttcggtctcgattcgccgatcgggcggctgtcg
gtcgcgatccgccgcggcgacgtacaggcggcgctcgaggcgctgcccgccgacgactcg
gccgccgcgtcgtttcacgacgatgcgggcgacacgctggcgtcgtcgacggtcgagcgg
ctcgcccggcgtttcggcgcctacctcgacgcattgcgcgatgcgctggccgcgccggcg
cccgatccgctgccgctgttcgacgcgctcaaccggttccggatcctgtgcgcgacccgc
agcggctcgcgcggcgcggaacacgtcaatgcgctggtggccgcgcacgtacggcatgcg
gctcgcgtgccgctcgcggtcggcgcgcactggttcaccgggcggccgatcatggttaca
cgcaacgactacgcgctggggctgttcaacggtgatatcggcattgcgctgcccgacgcg
catggcgtgctccgcgtgtggttccggcgcgcggacggcaccgcgcgggcggtgtcgccg
gctgcgctgccgccgcacgaaacggcgttcgcgctgacggtgcacaaatcgcagggctcg
gaattcgacgaagcggcgctcgtgctgcccgcgtcgtttggccgggtgctgacgcgcgag
ctggtctatacggccgtcacgcgcgcccgcacgcgcgtgcaggtgatcgggccgaggcgc
gtgctggcgcaggcggtcgcgacacgcacgcagcgcgattcggggctcgcggcccgcgtc
gacgaggcgcttgcccggcgccgcatggatgtttcgcgatga

DBGET integrated database retrieval system